(data stored in ACNUC7421 zone)

EMBL: CP000386.PE38

CP000386.PE38        Location/Qualifiers
FT   CDS             complement(39883..40782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM3004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03019"
FT                   /db_xref="GOA:Q1B009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B009"
FT                   /protein_id="ABG03019.1"
FT                   /translation="MSYGELIRDAFRTVWRNRYLWFFGFFVAGSGFSFNVPGGPPGGLP
FT                   DSLRWAGENLALVVAAAALLALVLLLVYLVLGVVSAGGLAWSVAAIERGERPGFSSTFR
FT                   AGLGSFWGVLGQAILLLLIGIGLALAVFVAVGGPFVLLLALTESVAARVVFGVLLGLLG
FT                   VVLLVVLYVPYAVVGQFALRELVVGRRGALDAIGGAFGLFRRNAGKSILVWVINLALSI
FT                   GVGVALAVVFILLGIALFMPAIALGTAGHEAAAVAAGVVAGLVLLPLLLVATGAVGAFF
FT                   HAYWTLAYLRLSGAAPPY"
     MSYGELIRDA FRTVWRNRYL WFFGFFVAGS GFSFNVPGGP PGGLPDSLRW AGENLALVVA        60
     AAALLALVLL LVYLVLGVVS AGGLAWSVAA IERGERPGFS STFRAGLGSF WGVLGQAILL       120
     LLIGIGLALA VFVAVGGPFV LLLALTESVA ARVVFGVLLG LLGVVLLVVL YVPYAVVGQF       180
     ALRELVVGRR GALDAIGGAF GLFRRNAGKS ILVWVINLAL SIGVGVALAV VFILLGIALF       240
     MPAIALGTAG HEAAAVAAGV VAGLVLLPLL LVATGAVGAF FHAYWTLAYL RLSGAAPPY        299
//

If you have problems or comments...

PBIL Back to PBIL home page