(data stored in ACNUC7421 zone)

EMBL: CP000386.PE380

CP000386.PE380       Location/Qualifiers
FT   CDS             413718..414488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03361"
FT                   /db_xref="GOA:Q1AZ17"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ17"
FT                   /protein_id="ABG03361.1"
FT                   /translation="MRESAALWPGSAVREVSLRSVDGLRLRAYWHPGGDRAAVLLHGKR
FT                   GSGRSEAVVATARVYAGAGFGVLVPDLRGRGGSEGRFLTAGYQEERDVRGALRWLAERG
FT                   FEARRVVLHGWSAGGAAALRAAPGAGVGAVVEDSAFAELPLLLGDLFPGPPRLLCGAAR
FT                   LVSRVLGTEFDPWALCPREDAARLYGEGVPLLIIHCRGDRVVPFRHAELLAAAHPAADF
FT                   WEVADGFHGGAYAHPGYRERLLGFVERALGPGGG"
     MRESAALWPG SAVREVSLRS VDGLRLRAYW HPGGDRAAVL LHGKRGSGRS EAVVATARVY        60
     AGAGFGVLVP DLRGRGGSEG RFLTAGYQEE RDVRGALRWL AERGFEARRV VLHGWSAGGA       120
     AALRAAPGAG VGAVVEDSAF AELPLLLGDL FPGPPRLLCG AARLVSRVLG TEFDPWALCP       180
     REDAARLYGE GVPLLIIHCR GDRVVPFRHA ELLAAAHPAA DFWEVADGFH GGAYAHPGYR       240
     ERLLGFVERA LGPGGG                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page