(data stored in ACNUC7421 zone)

EMBL: CP000386.PE382

CP000386.PE382       Location/Qualifiers
FT   CDS             complement(416553..417437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0388"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV; KEGG:
FT                   deh:cbdb_A1004 DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03363"
FT                   /db_xref="GOA:Q1AZ15"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ15"
FT                   /protein_id="ABG03363.1"
FT                   /translation="MAERRVAVVTESVSSLPRQLAGELEIEVVPVPFSYAGRDYLDGED
FT                   ITPEEFYGILRPDLPPASTSSPSPGAYLEVFRRLCGAGLEVLCVTATGKIATRMPESAR
FT                   MGRELAREEGVEGRIEVLDSGSAAMGEGFLALEAARMAWEGAGMEEILSRLEELSGRVS
FT                   LLVTLDTLQYLSKTARLRRLAALFAKALQIKPVILFERGEVRPLETPRTRRKAVERLLA
FT                   LAEERVSGEGPLHVAVQHAAAGEEAGELAEEVRERLGPRELLVAEFSPVMTSYAGPGLL
FT                   GLALYEEPPGAGP"
     MAERRVAVVT ESVSSLPRQL AGELEIEVVP VPFSYAGRDY LDGEDITPEE FYGILRPDLP        60
     PASTSSPSPG AYLEVFRRLC GAGLEVLCVT ATGKIATRMP ESARMGRELA REEGVEGRIE       120
     VLDSGSAAMG EGFLALEAAR MAWEGAGMEE ILSRLEELSG RVSLLVTLDT LQYLSKTARL       180
     RRLAALFAKA LQIKPVILFE RGEVRPLETP RTRRKAVERL LALAEERVSG EGPLHVAVQH       240
     AAAGEEAGEL AEEVRERLGP RELLVAEFSP VMTSYAGPGL LGLALYEEPP GAGP             294
//

If you have problems or comments...

PBIL Back to PBIL home page