(data stored in ACNUC7421 zone)

EMBL: CP000386.PE384

CP000386.PE384       Location/Qualifiers
FT   CDS             complement(418416..419072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0390"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   gsu:GSU0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03365"
FT                   /db_xref="GOA:Q1AZ13"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ13"
FT                   /protein_id="ABG03365.1"
FT                   /translation="MELSTLLEATVAFLLGYAAGSVPLGLLVAYLFAGIDIRRHGTGNV
FT                   GASNVWRNVGLLPAAVVALGVFLQGLLPPLAARLLGAQEEVVAAAALGPVVGYGWSPFL
FT                   GFRGGRGVGVSTGAAAALSPGGFLVLLAVYGLGRLADQMGLATVAGFALYAVYALWSAG
FT                   WSATGLAALALLALVLLRRLEGVSEDLRHHPALPTLAGRLLLDRRPGQRLRGRNG"
     MELSTLLEAT VAFLLGYAAG SVPLGLLVAY LFAGIDIRRH GTGNVGASNV WRNVGLLPAA        60
     VVALGVFLQG LLPPLAARLL GAQEEVVAAA ALGPVVGYGW SPFLGFRGGR GVGVSTGAAA       120
     ALSPGGFLVL LAVYGLGRLA DQMGLATVAG FALYAVYALW SAGWSATGLA ALALLALVLL       180
     RRLEGVSEDL RHHPALPTLA GRLLLDRRPG QRLRGRNG                               218
//

If you have problems or comments...

PBIL Back to PBIL home page