(data stored in ACNUC7421 zone)

EMBL: CP000386.PE385

CP000386.PE385       Location/Qualifiers
FT   CDS             419125..419676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03366"
FT                   /db_xref="GOA:Q1AZ12"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ12"
FT                   /protein_id="ABG03366.1"
FT                   /translation="MGVMWGVVAVGEPVAGVLVFLLGGALRAARALRDLPGRRRAPGAL
FT                   PARYRLHGVELFPGIGVPLSRTTRYGATFAGVHRGEPAALLLGWVNYTPIFFKPSTECA
FT                   VVGGRWWLVAAEGGRPRVLRGRFGRGTVRWDGKGKLAAAEVGVRLGGRGGEGRLAAALN
FT                   HLPFPPRIGGALRLPGASGP"
     MGVMWGVVAV GEPVAGVLVF LLGGALRAAR ALRDLPGRRR APGALPARYR LHGVELFPGI        60
     GVPLSRTTRY GATFAGVHRG EPAALLLGWV NYTPIFFKPS TECAVVGGRW WLVAAEGGRP       120
     RVLRGRFGRG TVRWDGKGKL AAAEVGVRLG GRGGEGRLAA ALNHLPFPPR IGGALRLPGA       180
     SGP                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page