(data stored in ACNUC7421 zone)

EMBL: CP000386.PE386

CP000386.PE386       Location/Qualifiers
FT   CDS             complement(419665..420849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0392"
FT                   /product="oxidoreductase-like protein"
FT                   /note="PFAM: oxidoreductase-like Oxidoreductase-like; KEGG:
FT                   bms:BR0546 oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03367"
FT                   /db_xref="GOA:Q1AZ11"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ11"
FT                   /protein_id="ABG03367.1"
FT                   /translation="MQRLKMGMVGGGEGSFIGAVHRRAAALDGEIELVAGALSSTPEKA
FT                   LRSGRALGLPEGRNYASWEEMLEGELALPEEERIDFVSIVTPNHMHFPVARAFVRAGFD
FT                   VICDKPLVHTSEQALELVRAVEKAGTIFCVTYNYTGYPMVRQARHMVRSGMLGELRKVI
FT                   VEYSQGWLVRRLEDEDKQARWRTDPSLAGAAGAIGDIGSHAENLVATVTGLRISEICAD
FT                   LTTFVEGRRLDDDGNLLVRYEGGAKGVMISSQISTGEENNLSLRVYGTEGALQWRQEEP
FT                   NHLLFAPFGKPVQTLRRGNPYLCEEARAASRLPAGHPEAFIEAFANLYLEAAAAMRARR
FT                   GLSPERPPDFPTVYDGARGVHFIERVVESSRSEKKWLDARWEAPQPEGAGASGP"
     MQRLKMGMVG GGEGSFIGAV HRRAAALDGE IELVAGALSS TPEKALRSGR ALGLPEGRNY        60
     ASWEEMLEGE LALPEEERID FVSIVTPNHM HFPVARAFVR AGFDVICDKP LVHTSEQALE       120
     LVRAVEKAGT IFCVTYNYTG YPMVRQARHM VRSGMLGELR KVIVEYSQGW LVRRLEDEDK       180
     QARWRTDPSL AGAAGAIGDI GSHAENLVAT VTGLRISEIC ADLTTFVEGR RLDDDGNLLV       240
     RYEGGAKGVM ISSQISTGEE NNLSLRVYGT EGALQWRQEE PNHLLFAPFG KPVQTLRRGN       300
     PYLCEEARAA SRLPAGHPEA FIEAFANLYL EAAAAMRARR GLSPERPPDF PTVYDGARGV       360
     HFIERVVESS RSEKKWLDAR WEAPQPEGAG ASGP                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page