(data stored in ACNUC7421 zone)

EMBL: CP000386.PE387

CP000386.PE387       Location/Qualifiers
FT   CDS             complement(420851..421852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0393"
FT                   /product="Xylose isomerase-like TIM barrel"
FT                   /note="PFAM: AP endonuclease 2-like Xylose isomerase-like
FT                   TIM barrel; KEGG: rba:RB4654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03368"
FT                   /db_xref="GOA:Q1AZ10"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ10"
FT                   /protein_id="ABG03368.1"
FT                   /translation="MPRRPVTLFTGQWADLPLEELAPLAREMGYDGLELACWGDHFDVR
FT                   RALEDEGYAAGRRELLSSHDLRCWAIGNHLVGQAVCDPIDERHRATLPERVWGDGDPEG
FT                   VRRRAAEEMKDTARAARRLGVEVVTGFTGSSVWHKLYFFPPTPHEEVEAGYEDFARRWN
FT                   PILDVFDEEGVRFAFEVHPTEIAYDLYSAERALEAVGGRRAFGFNFDPSHLYWQFVDPV
FT                   KFIDRFADRIYHVHMKDAARTLDGQSGILSSHLPFGDHRRGWDFRSLGRGGVDFEEIVR
FT                   ALNRTGYGGPLSVEWEDSGMDRVHGARESAAFVRRLDFEPSGVAFDAAFGEE"
     MPRRPVTLFT GQWADLPLEE LAPLAREMGY DGLELACWGD HFDVRRALED EGYAAGRREL        60
     LSSHDLRCWA IGNHLVGQAV CDPIDERHRA TLPERVWGDG DPEGVRRRAA EEMKDTARAA       120
     RRLGVEVVTG FTGSSVWHKL YFFPPTPHEE VEAGYEDFAR RWNPILDVFD EEGVRFAFEV       180
     HPTEIAYDLY SAERALEAVG GRRAFGFNFD PSHLYWQFVD PVKFIDRFAD RIYHVHMKDA       240
     ARTLDGQSGI LSSHLPFGDH RRGWDFRSLG RGGVDFEEIV RALNRTGYGG PLSVEWEDSG       300
     MDRVHGARES AAFVRRLDFE PSGVAFDAAF GEE                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page