(data stored in ACNUC7421 zone)

EMBL: CP000386.PE39

CP000386.PE39        Location/Qualifiers
FT   CDS             complement(40779..42215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0039"
FT                   /product="protein of unknown function DUF407"
FT                   /note="PFAM: protein of unknown function DUF407; KEGG:
FT                   fra:Francci3_2911 enzymatic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03020"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B008"
FT                   /protein_id="ABG03020.1"
FT                   /translation="MPRGIGYNRFSVRFERKLPGPNEVFFPDGSPRPGYGPLLEELEET
FT                   GPARWLERLEKARSLLLEEQRSFGLLGGDRTHPTDWFPRIVAAPDWERLERGIAQRMRA
FT                   LNAFLRRLEAGKEEVVPPEVLESSILYDQDTPNRFGPVPVRQVAFDVVAVEGGAGGWEY
FT                   VVIEENAKMPVGLAPMTRRRALSAGLFFPKTYEGLGVRGLDGWLGRLGEALRAASPRGR
FT                   EATLAVVSGGPGDQFYLDHHIYASEMGALLAEPGELEVDGEGYLVHRPSGRRVDVVYER
FT                   VDEDRLYAEVPGLLRCHLEGRVHVLFAPNSEVVDDKGVYPFIPEMVRRYLGEEPILENA
FT                   RTWSLAIEEDRRYVMRNFERLVVKSRGGYGGKEVMIGPEESAEARERFRRMVESNPVEY
FT                   IAQPPLEFSTHVLCDVEEGEFVLRDSYADYRVLALAPDPQDPDVVEVVPGALARVAAPG
FT                   RRITNISSGGKMKDTWVPGR"
     MPRGIGYNRF SVRFERKLPG PNEVFFPDGS PRPGYGPLLE ELEETGPARW LERLEKARSL        60
     LLEEQRSFGL LGGDRTHPTD WFPRIVAAPD WERLERGIAQ RMRALNAFLR RLEAGKEEVV       120
     PPEVLESSIL YDQDTPNRFG PVPVRQVAFD VVAVEGGAGG WEYVVIEENA KMPVGLAPMT       180
     RRRALSAGLF FPKTYEGLGV RGLDGWLGRL GEALRAASPR GREATLAVVS GGPGDQFYLD       240
     HHIYASEMGA LLAEPGELEV DGEGYLVHRP SGRRVDVVYE RVDEDRLYAE VPGLLRCHLE       300
     GRVHVLFAPN SEVVDDKGVY PFIPEMVRRY LGEEPILENA RTWSLAIEED RRYVMRNFER       360
     LVVKSRGGYG GKEVMIGPEE SAEARERFRR MVESNPVEYI AQPPLEFSTH VLCDVEEGEF       420
     VLRDSYADYR VLALAPDPQD PDVVEVVPGA LARVAAPGRR ITNISSGGKM KDTWVPGR         478
//

If you have problems or comments...

PBIL Back to PBIL home page