(data stored in ACNUC7421 zone)

EMBL: CP000386.PE391

CP000386.PE391       Location/Qualifiers
FT   CDS             complement(425058..426566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0397"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   atc:AGR_L_992 high affinity ribose transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03372"
FT                   /db_xref="GOA:Q1AZ06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ06"
FT                   /protein_id="ABG03372.1"
FT                   /translation="MPGEVSLSARHLAKRYGGVVALADGNLEVSSGEVVALMGANGSGK
FT                   STLGKIITGAVVPDSGTLLLDGEEVRFSSPHAARRAGIAAVYQELSLIPDMTVAENVWL
FT                   AHEPLSRGLVKRRERRERTARLLELFRGVVGPSLGPDALVSRLSPGERQIVEILKALSA
FT                   EPRLMILDEATASLDGEQVARLFELVGGWKAQGRAVVFVSHRMEEIFRIADRAVVLRSG
FT                   RTVGEAETSRTTEQELISLMIEGGVTKRHIEHPPGPAGGRKILLRAEDLRAPGVRGVSL
FT                   ELARGEILGLGGLQGQGQPELLRALFGALPRSGRLLLGGREVRLSHPRQAMREGMAFVP
FT                   GDRGREGLLRVRSILENLMLPSWRRYGRLLDLKRARRDAERIAGELRIVMGSLDDPVDT
FT                   LSGGNAQKVVLGKWLLRAPQILLLDDPTKGVDVGAKGELYAMLGDLRKEGVAILLYSSD
FT                   DEELLGLCDRVLVMREGRVRRELKSPELTRSALVKASVGTEDGG"
     MPGEVSLSAR HLAKRYGGVV ALADGNLEVS SGEVVALMGA NGSGKSTLGK IITGAVVPDS        60
     GTLLLDGEEV RFSSPHAARR AGIAAVYQEL SLIPDMTVAE NVWLAHEPLS RGLVKRRERR       120
     ERTARLLELF RGVVGPSLGP DALVSRLSPG ERQIVEILKA LSAEPRLMIL DEATASLDGE       180
     QVARLFELVG GWKAQGRAVV FVSHRMEEIF RIADRAVVLR SGRTVGEAET SRTTEQELIS       240
     LMIEGGVTKR HIEHPPGPAG GRKILLRAED LRAPGVRGVS LELARGEILG LGGLQGQGQP       300
     ELLRALFGAL PRSGRLLLGG REVRLSHPRQ AMREGMAFVP GDRGREGLLR VRSILENLML       360
     PSWRRYGRLL DLKRARRDAE RIAGELRIVM GSLDDPVDTL SGGNAQKVVL GKWLLRAPQI       420
     LLLDDPTKGV DVGAKGELYA MLGDLRKEGV AILLYSSDDE ELLGLCDRVL VMREGRVRRE       480
     LKSPELTRSA LVKASVGTED GG                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page