(data stored in ACNUC7421 zone)

EMBL: CP000386.PE392

CP000386.PE392       Location/Qualifiers
FT   CDS             complement(426569..427666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0398"
FT                   /product="periplasmic sugar binding protein-like protein"
FT                   /note="KEGG: atc:AGR_L_993 periplasmic sugar binding
FT                   protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03373"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ05"
FT                   /protein_id="ABG03373.1"
FT                   /translation="MTGSSFARWGHRGAALLAAVAAVLLVAACGGGGSQQGSEGGAPYT
FT                   IGVSNGFISSEWRTQMIQDLERVNKEYMEEGLTEELVIESADVDVQGQIQQMRNLINQG
FT                   VDAIIVNPNSVTGLNQVIKEASDAGIVVISVDQEIPAEGAINVVIDQAEWARRSAEWLV
FT                   EQLGGEGDVVVINGIAGHPANEARYDAVKEVFSRNPGIEVIAEANANWDQATGQQKMSN
FT                   ILASETGIDGVWTQDGMARGVLQAIVASDPERFPVVVGEARLGYMRLWHELRQQDEDFS
FT                   SYGVINPPGVGASGLRVAVEMLRGKELKEGVLSGEANNTIYVPIPGVVNDQNFDEWYAR
FT                   VKDKEGEYVLDGIISREKAQSYFKQ"
     MTGSSFARWG HRGAALLAAV AAVLLVAACG GGGSQQGSEG GAPYTIGVSN GFISSEWRTQ        60
     MIQDLERVNK EYMEEGLTEE LVIESADVDV QGQIQQMRNL INQGVDAIIV NPNSVTGLNQ       120
     VIKEASDAGI VVISVDQEIP AEGAINVVID QAEWARRSAE WLVEQLGGEG DVVVINGIAG       180
     HPANEARYDA VKEVFSRNPG IEVIAEANAN WDQATGQQKM SNILASETGI DGVWTQDGMA       240
     RGVLQAIVAS DPERFPVVVG EARLGYMRLW HELRQQDEDF SSYGVINPPG VGASGLRVAV       300
     EMLRGKELKE GVLSGEANNT IYVPIPGVVN DQNFDEWYAR VKDKEGEYVL DGIISREKAQ       360
     SYFKQ                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page