(data stored in ACNUC7421 zone)

EMBL: CP000386.PE393

CP000386.PE393       Location/Qualifiers
FT   CDS             complement(427722..428930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0399"
FT                   /product="ROK domain containing protein"
FT                   /note="PFAM: ROK; KEGG: lxx:Lxx03030 transcriptional
FT                   regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03374"
FT                   /db_xref="GOA:Q1AZ04"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ04"
FT                   /protein_id="ABG03374.1"
FT                   /translation="MRSGESGTVGQIFGLIRSGRARTRAELAAVTGLTRATVSQRVEVL
FT                   MEAGLVVETKEGVSTGGRPPMVLGFNKDAGVVLAADLGATHCRLAVADLGGRPLVELPA
FT                   DLDIAQGPDAVLGWVQDRFEELLEEAGRSREEVWGIGVGVPGPVDFARGQAVSPPIMPG
FT                   WDRVPIPERFRERFGGVPVLVDNDVNIMALGEHRVNWSDVEHLLFVKVATGIGCGIVAG
FT                   GRIHRGERGAAGDIGHIRISGHEETVCRCGNVACVEAVAGGWALAKQLSGLGYPATGSR
FT                   DVVGLVRAGNPAAARLVRTAGELIGEVLASLVNFFNPAVIIIGGDLAHAHEQLFAGIRS
FT                   VVYQRSLPLATRHLQIVPSELDDRAGIHGAAAMVIEHVLRPETIEEMAQERIRRRAGRP
FT                   AGG"
     MRSGESGTVG QIFGLIRSGR ARTRAELAAV TGLTRATVSQ RVEVLMEAGL VVETKEGVST        60
     GGRPPMVLGF NKDAGVVLAA DLGATHCRLA VADLGGRPLV ELPADLDIAQ GPDAVLGWVQ       120
     DRFEELLEEA GRSREEVWGI GVGVPGPVDF ARGQAVSPPI MPGWDRVPIP ERFRERFGGV       180
     PVLVDNDVNI MALGEHRVNW SDVEHLLFVK VATGIGCGIV AGGRIHRGER GAAGDIGHIR       240
     ISGHEETVCR CGNVACVEAV AGGWALAKQL SGLGYPATGS RDVVGLVRAG NPAAARLVRT       300
     AGELIGEVLA SLVNFFNPAV IIIGGDLAHA HEQLFAGIRS VVYQRSLPLA TRHLQIVPSE       360
     LDDRAGIHGA AAMVIEHVLR PETIEEMAQE RIRRRAGRPA GG                          402
//

If you have problems or comments...

PBIL Back to PBIL home page