(data stored in ACNUC7421 zone)

EMBL: CP000386.PE396

CP000386.PE396       Location/Qualifiers
FT   CDS             431365..432861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0402"
FT                   /product="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="KEGG: mta:Moth_2025 xylulokinase; TIGRFAM:
FT                   xylulokinase; PFAM: carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03377"
FT                   /db_xref="GOA:Q1AZ01"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ01"
FT                   /protein_id="ABG03377.1"
FT                   /translation="MSPLVGLDIGTGGARAVAVEESGGILAEATSSYPLTSPRPGWTEQ
FT                   DPEEWWRAAREVLGRVAAEVGGEVRGIGLTGQMHGSVFLDAGERPIRPALLWNDQRTAR
FT                   QCAEISGLVGAERLIAIAGNPALTGFQAPKILWLREEEPQNYRRVASVLLPKDYIRLRL
FT                   TGERATDASDAAGTLLLDVGRREWSEEILSRLEIPRGWLPRVYEGPEATGALRGGVASE
FT                   LGLPAGIPVAAGGGDNAAAAVGVGVVREGILSSSVGTSGVLFAHTDAFSPDPSGRVHAF
FT                   CHALPGAYHLMGVTLSAGGSLAWWRSTLEKDYEVLVEEAAQVPPGAEGLLFLPYLTGER
FT                   TPHLDPAARGAFIGLTARHTAAHMSRAVMEGVVFSLRESLEILRSLGVPVEEVRATGGG
FT                   ARSPLWRQLQADIYNTPIRRTTADEGPAYGAALLGGVAAGAYRDVQEAVASCVRLREEL
FT                   TEPDERRSKAYEEHYAVYRSLYAANREAMHRLSELAGSAS"
     MSPLVGLDIG TGGARAVAVE ESGGILAEAT SSYPLTSPRP GWTEQDPEEW WRAAREVLGR        60
     VAAEVGGEVR GIGLTGQMHG SVFLDAGERP IRPALLWNDQ RTARQCAEIS GLVGAERLIA       120
     IAGNPALTGF QAPKILWLRE EEPQNYRRVA SVLLPKDYIR LRLTGERATD ASDAAGTLLL       180
     DVGRREWSEE ILSRLEIPRG WLPRVYEGPE ATGALRGGVA SELGLPAGIP VAAGGGDNAA       240
     AAVGVGVVRE GILSSSVGTS GVLFAHTDAF SPDPSGRVHA FCHALPGAYH LMGVTLSAGG       300
     SLAWWRSTLE KDYEVLVEEA AQVPPGAEGL LFLPYLTGER TPHLDPAARG AFIGLTARHT       360
     AAHMSRAVME GVVFSLRESL EILRSLGVPV EEVRATGGGA RSPLWRQLQA DIYNTPIRRT       420
     TADEGPAYGA ALLGGVAAGA YRDVQEAVAS CVRLREELTE PDERRSKAYE EHYAVYRSLY       480
     AANREAMHRL SELAGSAS                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page