(data stored in ACNUC7421 zone)

EMBL: CP000386.PE4

CP000386.PE4         Location/Qualifiers
FT   CDS             3171..4295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC protein-like; KEGG: oih:OB0004 DNA repair and
FT                   genetic recombination"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02985"
FT                   /db_xref="GOA:Q1B043"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B043"
FT                   /protein_id="ABG02985.1"
FT                   /translation="MSAHIRAIRLVNFRNYAGATALLSPGLNVLVGENAQGKTNLLEAL
FT                   AFVVSGSSPRTPNDSEVVRWGEGFVRVEARVVDGGHERRLAVGYAPGSRKRLTVDGAPV
FT                   ESLARYAAGVAGVRAVTFFPDDLRVVKGSPSDRRSFLDALLSSLRPAYARAAAEYARAV
FT                   QQRNQLLRRIRDGLSSERTLATWDRKVVELGLVLLEGRAAAAAPLDEHFRASMRALYGP
FT                   QKAAVGYSYSATPERYAQALREAHSADIERGITSVGPHRDDLRILLEGVDLTTYGSQGQ
FT                   QRLATLALKFAARDYIRDATGQDPVLLFDDVMSELDERRRDYLAGCFLESTQAVISTTN
FT                   LRYFEPGALRRARVLGISGGSISQTTKSGVDNGG"
     MSAHIRAIRL VNFRNYAGAT ALLSPGLNVL VGENAQGKTN LLEALAFVVS GSSPRTPNDS        60
     EVVRWGEGFV RVEARVVDGG HERRLAVGYA PGSRKRLTVD GAPVESLARY AAGVAGVRAV       120
     TFFPDDLRVV KGSPSDRRSF LDALLSSLRP AYARAAAEYA RAVQQRNQLL RRIRDGLSSE       180
     RTLATWDRKV VELGLVLLEG RAAAAAPLDE HFRASMRALY GPQKAAVGYS YSATPERYAQ       240
     ALREAHSADI ERGITSVGPH RDDLRILLEG VDLTTYGSQG QQRLATLALK FAARDYIRDA       300
     TGQDPVLLFD DVMSELDERR RDYLAGCFLE STQAVISTTN LRYFEPGALR RARVLGISGG       360
     SISQTTKSGV DNGG                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page