(data stored in ACNUC7421 zone)

EMBL: CP000386.PE409

CP000386.PE409       Location/Qualifiers
FT   CDS             448438..449292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0416"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   syn:slr1318 ABC-type iron(III) dicitrate transport system
FT                   ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03390"
FT                   /db_xref="GOA:Q1AYY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY8"
FT                   /protein_id="ABG03390.1"
FT                   /translation="MKELGRLLKRVEAPAGPAKLRAEGLVLGYDEATVIDGLEVEVPPG
FT                   RITSVVGPNGCGKSTLLRSLARLLRPRGGGVYLDGKEIFSLPTREVARRLGILPQSPEA
FT                   PEGLTVRELAAQGRYPHQSWLSQWSASDERAVERALQKTGMLPLADRPLDTLSGGQRQR
FT                   AWISMALAQETETLLLDEPTTFLDLAHQLEVLQLLGRLNAEEGRTVVMVLHDLNNAARY
FT                   SHHVIALHDGGVYAAGPPEEVVTPELLRDVFHVEADVVADPRTGLPLCVPYGLRRRAEG
FT                   EEA"
     MKELGRLLKR VEAPAGPAKL RAEGLVLGYD EATVIDGLEV EVPPGRITSV VGPNGCGKST        60
     LLRSLARLLR PRGGGVYLDG KEIFSLPTRE VARRLGILPQ SPEAPEGLTV RELAAQGRYP       120
     HQSWLSQWSA SDERAVERAL QKTGMLPLAD RPLDTLSGGQ RQRAWISMAL AQETETLLLD       180
     EPTTFLDLAH QLEVLQLLGR LNAEEGRTVV MVLHDLNNAA RYSHHVIALH DGGVYAAGPP       240
     EEVVTPELLR DVFHVEADVV ADPRTGLPLC VPYGLRRRAE GEEA                        284
//

If you have problems or comments...

PBIL Back to PBIL home page