(data stored in ACNUC7421 zone)

EMBL: CP000386.PE41

CP000386.PE41        Location/Qualifiers
FT   CDS             43068..43793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0041"
FT                   /product="IstB-like ATP-binding protein"
FT                   /note="PFAM: IstB-like ATP-binding protein; SMART: ATPase;
FT                   KEGG: bat:BAS3827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03022"
FT                   /db_xref="GOA:Q1B006"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B006"
FT                   /protein_id="ABG03022.1"
FT                   /translation="MEFPPALQRKFGRPGEWYYHPCTPECERKNERREWELMRRDARVA
FT                   ALRERSGLSRRMKGYTLSGFNPYVSPAAAKALEKVEAYLKGWEENREQGRGLYFCGGVG
FT                   TGKTHLAVAVMNELIQRRRVPSLFVTVPELLDNLRGAYNDPGRDLDEWMDAVKNAELLL
FT                   LDDLGAEKANEWVRERLFVIINHRYREALPTIFTSNIGPEELPRQLGERTASRIIAMCE
FT                   GVELEGPDYREKLRNERGA"
     MEFPPALQRK FGRPGEWYYH PCTPECERKN ERREWELMRR DARVAALRER SGLSRRMKGY        60
     TLSGFNPYVS PAAAKALEKV EAYLKGWEEN REQGRGLYFC GGVGTGKTHL AVAVMNELIQ       120
     RRRVPSLFVT VPELLDNLRG AYNDPGRDLD EWMDAVKNAE LLLLDDLGAE KANEWVRERL       180
     FVIINHRYRE ALPTIFTSNI GPEELPRQLG ERTASRIIAM CEGVELEGPD YREKLRNERG       240
     A                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page