(data stored in ACNUC7421 zone)

EMBL: CP000386.PE414

CP000386.PE414       Location/Qualifiers
FT   CDS             complement(452661..452861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0421"
FT                   /product="protein of unknown function DUF466"
FT                   /note="PFAM: protein of unknown function DUF466; KEGG:
FT                   bur:Bcep18194_B0098 protein of unknown function DUF466"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03395"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY3"
FT                   /protein_id="ABG03395.1"
FT                   /translation="MAHGNRLGAALRYAWDYLKEVSGENAYDHYLRRHRATHPGKPPMS
FT                   RREFYRRRQDERFSNPGSRCP"
     MAHGNRLGAA LRYAWDYLKE VSGENAYDHY LRRHRATHPG KPPMSRREFY RRRQDERFSN        60
     PGSRCP                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page