(data stored in ACNUC7421 zone)

EMBL: CP000386.PE415

CP000386.PE415       Location/Qualifiers
FT   CDS             complement(452874..454997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0422"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   fra:Francci3_2468 carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03396"
FT                   /db_xref="GOA:Q1AYY2"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY2"
FT                   /protein_id="ABG03396.1"
FT                   /translation="MGSRLKRYGIWVLVAVVGAVCWGVLALARGETINAGWLLFAAIAS
FT                   YAIAYRFYARFIQTRVLETDDSRATPAERLENGRDFVPMDRRILFGHHFAAIAGAGPLV
FT                   GPVLAAQMGFLPGTIWIIFGVILAGAVQDMTTLFFSMRRDGKTLGQMAREEIGPVGGAA
FT                   ALIAVMSIMVILLAVLALVVVNALTASPWGSFSLLMTVPIAIFMGFYLRFLRPGRVIEV
FT                   SLIGFALLILAIVGGGWISESGYAEAWTFEGTTITWALIIYGFVASVLPVWVLLAPRDY
FT                   LSTFMKIGTVLLLAVGIALTLPAMQMPRTTQFAFNGEGPVFSGPLFPFVFIIVACGALS
FT                   GFHSLIASGTTPKLIAKESQVRMIGYGAMLMESFVAVMAMIAACILDPGVYFAMNAPAG
FT                   VLGETARSAAEAVRGFGFTVTPETLNQIAQNVGEESIIARTGGAPTLAVGMSQILSSLL
FT                   GGTTLQAFWYHFAIMFEALFILTTVDAGTRVGRFMLQDMIGNVWRPFARTSWLPANIVA
FT                   SALIVAAWGYFLYAGVTDPLGGINQLFPLFGIANQLLAAVALTVGTTILIKMGKLKWAW
FT                   VTALPLAWDASVTLTASWYKIFSPDPSIGFFAQRAAFQEALANGEVVAPAQSLEDMRQV
FT                   VLNSTVDGILSILFALMIIIVILDAARVWVGVITGRKPAETTEAPYERSRLDHEGKPLE
FT                   PEPVGAGGSPSSS"
     MGSRLKRYGI WVLVAVVGAV CWGVLALARG ETINAGWLLF AAIASYAIAY RFYARFIQTR        60
     VLETDDSRAT PAERLENGRD FVPMDRRILF GHHFAAIAGA GPLVGPVLAA QMGFLPGTIW       120
     IIFGVILAGA VQDMTTLFFS MRRDGKTLGQ MAREEIGPVG GAAALIAVMS IMVILLAVLA       180
     LVVVNALTAS PWGSFSLLMT VPIAIFMGFY LRFLRPGRVI EVSLIGFALL ILAIVGGGWI       240
     SESGYAEAWT FEGTTITWAL IIYGFVASVL PVWVLLAPRD YLSTFMKIGT VLLLAVGIAL       300
     TLPAMQMPRT TQFAFNGEGP VFSGPLFPFV FIIVACGALS GFHSLIASGT TPKLIAKESQ       360
     VRMIGYGAML MESFVAVMAM IAACILDPGV YFAMNAPAGV LGETARSAAE AVRGFGFTVT       420
     PETLNQIAQN VGEESIIART GGAPTLAVGM SQILSSLLGG TTLQAFWYHF AIMFEALFIL       480
     TTVDAGTRVG RFMLQDMIGN VWRPFARTSW LPANIVASAL IVAAWGYFLY AGVTDPLGGI       540
     NQLFPLFGIA NQLLAAVALT VGTTILIKMG KLKWAWVTAL PLAWDASVTL TASWYKIFSP       600
     DPSIGFFAQR AAFQEALANG EVVAPAQSLE DMRQVVLNST VDGILSILFA LMIIIVILDA       660
     ARVWVGVITG RKPAETTEAP YERSRLDHEG KPLEPEPVGA GGSPSSS                     707
//

If you have problems or comments...

PBIL Back to PBIL home page