(data stored in ACNUC7421 zone)

EMBL: CP000386.PE417

CP000386.PE417       Location/Qualifiers
FT   CDS             complement(455793..456743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0424"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ape:APE2579 putative ABC-2 type transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03398"
FT                   /db_xref="GOA:Q1AYY0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY0"
FT                   /protein_id="ABG03398.1"
FT                   /translation="MASAALEAENITRRYRSSGRGVEGVSLSVAPGEVLGLVGPNGSGK
FT                   STLLRVLSTAIAPDSGAFRVCGLDGLRERRKVRARLGIMVDRPTHYGDLSGWANAYLFA
FT                   RAYGVPEEKADRALRGLFEHFGLAEYRDEKAKTYSYGMAKKLALIEALAHEPAVLLLDE
FT                   PSLGLDYTSRLAYQRKLREAAENGCAVLLASNQVDEVEALCDRVVFLHRGRAVAEGTPE
FT                   GLVSSLEGLRRVVAALRNPVPYAEVGEVPGVRRVVPEGRGLVVHCEDRPGIVAGVVGAI
FT                   VRCGGDITGLSVERPTLEDVFARLTGEALRGEDEA"
     MASAALEAEN ITRRYRSSGR GVEGVSLSVA PGEVLGLVGP NGSGKSTLLR VLSTAIAPDS        60
     GAFRVCGLDG LRERRKVRAR LGIMVDRPTH YGDLSGWANA YLFARAYGVP EEKADRALRG       120
     LFEHFGLAEY RDEKAKTYSY GMAKKLALIE ALAHEPAVLL LDEPSLGLDY TSRLAYQRKL       180
     REAAENGCAV LLASNQVDEV EALCDRVVFL HRGRAVAEGT PEGLVSSLEG LRRVVAALRN       240
     PVPYAEVGEV PGVRRVVPEG RGLVVHCEDR PGIVAGVVGA IVRCGGDITG LSVERPTLED       300
     VFARLTGEAL RGEDEA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page