(data stored in ACNUC7421 zone)

EMBL: CP000386.PE418

CP000386.PE418       Location/Qualifiers
FT   CDS             456903..457787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0425"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: sma:SAV1542 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03399"
FT                   /db_xref="GOA:Q1AYX9"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX9"
FT                   /protein_id="ABG03399.1"
FT                   /translation="MNGNVSVAVLGTGIMGSAMARNLLKAGMEVRVWNRTRSRAEPLAA
FT                   EGARVADSPREAARGAGVLLTMLADAGAVAGAVGGGALEALSPGAVWLQMSTVGVEGTG
FT                   RLQRMALERGVAYVDAPVLGTRQPAEAGELVVLASGPEEVRPACEPVFEAVGKKTLWVG
FT                   PVGAGTRLKLVVNNWITGLLGVLGETFALAQKLGVDPSLFFEAVEGGPLDLPYARAKGK
FT                   MMAEGEYPTSFSVRLARKDAGLVLEAAEDLRLPVCEAVAYHLDRAAETGHAEDDMAAIY
FT                   EGVRTAAEPGGAG"
     MNGNVSVAVL GTGIMGSAMA RNLLKAGMEV RVWNRTRSRA EPLAAEGARV ADSPREAARG        60
     AGVLLTMLAD AGAVAGAVGG GALEALSPGA VWLQMSTVGV EGTGRLQRMA LERGVAYVDA       120
     PVLGTRQPAE AGELVVLASG PEEVRPACEP VFEAVGKKTL WVGPVGAGTR LKLVVNNWIT       180
     GLLGVLGETF ALAQKLGVDP SLFFEAVEGG PLDLPYARAK GKMMAEGEYP TSFSVRLARK       240
     DAGLVLEAAE DLRLPVCEAV AYHLDRAAET GHAEDDMAAI YEGVRTAAEP GGAG             294
//

If you have problems or comments...

PBIL Back to PBIL home page