(data stored in ACNUC7421 zone)

EMBL: CP000386.PE42

CP000386.PE42        Location/Qualifiers
FT   CDS             43790..44395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03023"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B005"
FT                   /protein_id="ABG03023.1"
FT                   /translation="MREEFLITRQGRQYVLFAGLLDEAHARGLRSIETELLQVPEEANG
FT                   MTAIVRARVEMEDGRTFSGLGDANPQNVGRSIAPHLIRMAETRAKARALRDAVNVGATA
FT                   LEELTDGEESPPVEEARSRRPRPVEEAPPGEGGSEAGRRGGRVRRSQLELLRTLAVEAR
FT                   GENGVERLERHIGKPLSELTREEAEAWIDRLTPAGGRE"
     MREEFLITRQ GRQYVLFAGL LDEAHARGLR SIETELLQVP EEANGMTAIV RARVEMEDGR        60
     TFSGLGDANP QNVGRSIAPH LIRMAETRAK ARALRDAVNV GATALEELTD GEESPPVEEA       120
     RSRRPRPVEE APPGEGGSEA GRRGGRVRRS QLELLRTLAV EARGENGVER LERHIGKPLS       180
     ELTREEAEAW IDRLTPAGGR E                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page