(data stored in ACNUC7421 zone)

EMBL: CP000386.PE420

CP000386.PE420       Location/Qualifiers
FT   CDS             complement(459259..460062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03401"
FT                   /db_xref="GOA:Q1AYX7"
FT                   /db_xref="InterPro:IPR018688"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX7"
FT                   /protein_id="ABG03401.1"
FT                   /translation="MWAAPRDLHNRIFVALMALIALAWLALWLWGASPYAPYLDHEELG
FT                   HLASGGAGAGGLAARLAPLVALFVSGWTLMVVAMMLPTSLPLVLLFGRLTRRRPDGRLL
FT                   LALLLCGYVSVWALFGALAFLGDLLVHEGAERSAWLGDNPWAIGAGTLALAGLYQFAPL
FT                   KNRCLQRCRSPLGFITEHWRGERERSRAFRLGAHHGIFCLGCCWSLMLVMFAVGAGSLL
FT                   WMLLLGAVMAAEKNAGWGRRISAPVGIALLCWAAAMALGGVPALR"
     MWAAPRDLHN RIFVALMALI ALAWLALWLW GASPYAPYLD HEELGHLASG GAGAGGLAAR        60
     LAPLVALFVS GWTLMVVAMM LPTSLPLVLL FGRLTRRRPD GRLLLALLLC GYVSVWALFG       120
     ALAFLGDLLV HEGAERSAWL GDNPWAIGAG TLALAGLYQF APLKNRCLQR CRSPLGFITE       180
     HWRGERERSR AFRLGAHHGI FCLGCCWSLM LVMFAVGAGS LLWMLLLGAV MAAEKNAGWG       240
     RRISAPVGIA LLCWAAAMAL GGVPALR                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page