(data stored in ACNUC7421 zone)

EMBL: CP000386.PE421

CP000386.PE421       Location/Qualifiers
FT   CDS             complement(460129..460749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0428"
FT                   /product="protein of unknown function DUF1326"
FT                   /note="PFAM: protein of unknown function DUF1326; KEGG:
FT                   rso:RS01737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03402"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX6"
FT                   /protein_id="ABG03402.1"
FT                   /translation="MAYQLEGRLLEVCDCNVLCPCWIGEDPDGGTCDAVVAWKVDRGTV
FT                   DGVDVSGHTFAVLNYIPGNIFEGNWRAVVFVDEDATEEQQEALLNVFTGRLGGPMAEFA
FT                   QLIGEVVAVERAPITFTVEEGKGTLRIGSGTNPIAEAEMASYMGATEKPTTLQETVFST
FT                   IPGSPAYVSKATKYRRNSSGYGLRDVDLEGHNAIQGHFKLEAA"
     MAYQLEGRLL EVCDCNVLCP CWIGEDPDGG TCDAVVAWKV DRGTVDGVDV SGHTFAVLNY        60
     IPGNIFEGNW RAVVFVDEDA TEEQQEALLN VFTGRLGGPM AEFAQLIGEV VAVERAPITF       120
     TVEEGKGTLR IGSGTNPIAE AEMASYMGAT EKPTTLQETV FSTIPGSPAY VSKATKYRRN       180
     SSGYGLRDVD LEGHNAIQGH FKLEAA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page