(data stored in ACNUC7421 zone)

EMBL: CP000386.PE429

CP000386.PE429       Location/Qualifiers
FT   CDS             complement(465816..468224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0436"
FT                   /product="UspA"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein UspA; KEGG:
FT                   mma:MM1452 universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03410"
FT                   /db_xref="GOA:Q1AYW8"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW8"
FT                   /protein_id="ABG03410.1"
FT                   /translation="MSERTMSGAPRGAPRAGGILASSKARGDMYKEVYVPVDNSDYSNQ
FT                   ACVIGVDVARAFGGRVAGCHAYAAKMHDVRFRQMESGLPEEFRDEEEMQRQRKIHDQLI
FT                   TKGLEIITDSYIDVLEPLCEKYDVELVRRSLEGKNFKVIVEDVNSGDYDLVVMGAMGMA
FT                   AVKDTVLGSVTERVTRRLKKADCLIVKDLDRSPFEHIVVTIDGSAKSLGGLKRAIDLAR
FT                   EFGGTVEAISVFDPYFHYAMFHSIAGVLSTKAQKVFRFKEQEKLHEEIIDSGLAKIYTA
FT                   HLEVAKKVAADEGVELKTTLLAGKPFEQTLKYVREVEPSLVVMGRIGYHSDEDMDIGSN
FT                   TENMMRYLPTNVLVVNYEYQAPDLYTAEEHITWTKEALERMDRVPGFVVGMASGAVIRY
FT                   AIEKGYTVITTSVIDEVIENILPPGAMESMRAIGDQIRAQEAAGEEAPVDSLFKDFEER
FT                   TRQNGSSNGHRNGTSDPEKEAKREIIEGGRGGFGKAEDQGDVEGISEEVQEEIQRAAQG
FT                   RDRFECDVCRYVAKGKPARCPVCGAGPTHFHPVDAEIATAAAGENLNRSEVYDGRELHW
FT                   TDEAQAFLDSLEGWQEKRRVKARAEKSALKKGYTTITREYVEQQYREETGREAPETKRG
FT                   GGCPVHQAKEKVERETGGKCPIDHRAFKEAGRRVPEGGSGEFAWTEDAVARLERVPKGF
FT                   MRNISRNMTEKLARKKGVREIDMPLIEEALEGARNTMEDVITGKISIAELARDTGEKIE
FT                   AGENGEAPHPNLTVTMVCTTCGEEMEGIQPPEECPVCGAPAEDFEQKGR"
     MSERTMSGAP RGAPRAGGIL ASSKARGDMY KEVYVPVDNS DYSNQACVIG VDVARAFGGR        60
     VAGCHAYAAK MHDVRFRQME SGLPEEFRDE EEMQRQRKIH DQLITKGLEI ITDSYIDVLE       120
     PLCEKYDVEL VRRSLEGKNF KVIVEDVNSG DYDLVVMGAM GMAAVKDTVL GSVTERVTRR       180
     LKKADCLIVK DLDRSPFEHI VVTIDGSAKS LGGLKRAIDL AREFGGTVEA ISVFDPYFHY       240
     AMFHSIAGVL STKAQKVFRF KEQEKLHEEI IDSGLAKIYT AHLEVAKKVA ADEGVELKTT       300
     LLAGKPFEQT LKYVREVEPS LVVMGRIGYH SDEDMDIGSN TENMMRYLPT NVLVVNYEYQ       360
     APDLYTAEEH ITWTKEALER MDRVPGFVVG MASGAVIRYA IEKGYTVITT SVIDEVIENI       420
     LPPGAMESMR AIGDQIRAQE AAGEEAPVDS LFKDFEERTR QNGSSNGHRN GTSDPEKEAK       480
     REIIEGGRGG FGKAEDQGDV EGISEEVQEE IQRAAQGRDR FECDVCRYVA KGKPARCPVC       540
     GAGPTHFHPV DAEIATAAAG ENLNRSEVYD GRELHWTDEA QAFLDSLEGW QEKRRVKARA       600
     EKSALKKGYT TITREYVEQQ YREETGREAP ETKRGGGCPV HQAKEKVERE TGGKCPIDHR       660
     AFKEAGRRVP EGGSGEFAWT EDAVARLERV PKGFMRNISR NMTEKLARKK GVREIDMPLI       720
     EEALEGARNT MEDVITGKIS IAELARDTGE KIEAGENGEA PHPNLTVTMV CTTCGEEMEG       780
     IQPPEECPVC GAPAEDFEQK GR                                                802
//

If you have problems or comments...

PBIL Back to PBIL home page