(data stored in ACNUC7421 zone)

EMBL: CP000386.PE431

CP000386.PE431       Location/Qualifiers
FT   CDS             complement(469776..470513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0438"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: det:DET0814 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03412"
FT                   /db_xref="GOA:Q1AYW6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW6"
FT                   /protein_id="ABG03412.1"
FT                   /translation="MRRTLIVGGRVLRQLRRNPRFLVLSIVGPLVIVYFLKLFFDTFPE
FT                   GFDTGRYAVPAAAFIVHFMAFLLCAIALVQERTAGTMERMFVNGFRRAEVIGGYVLGYL
FT                   GLATLQAAVALGEVLWLFELDYDADALAALFAVVWLLAIASVMLGIFVSTFARREGQVF
FT                   PFVPLIILPSVFLSGFLVDVDELPGWAGWLGHAFPMLYANNVIQEMIEPGGALADVWTN
FT                   FAVLAGYGAALLALASLTLREVE"
     MRRTLIVGGR VLRQLRRNPR FLVLSIVGPL VIVYFLKLFF DTFPEGFDTG RYAVPAAAFI        60
     VHFMAFLLCA IALVQERTAG TMERMFVNGF RRAEVIGGYV LGYLGLATLQ AAVALGEVLW       120
     LFELDYDADA LAALFAVVWL LAIASVMLGI FVSTFARREG QVFPFVPLII LPSVFLSGFL       180
     VDVDELPGWA GWLGHAFPML YANNVIQEMI EPGGALADVW TNFAVLAGYG AALLALASLT       240
     LREVE                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page