(data stored in ACNUC7421 zone)

EMBL: CP000386.PE432

CP000386.PE432       Location/Qualifiers
FT   CDS             complement(470510..471361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0439"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   chy:CHY_0900 daunorubicin resistance ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03413"
FT                   /db_xref="GOA:Q1AYW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW5"
FT                   /protein_id="ABG03413.1"
FT                   /translation="MDAVEAVGLEKRYGKQVEALRGVDLSVRKGEVFGLVGPNGAGKTT
FT                   LIKALVGSLRPSGGRARVLGLDPLRDRPELRRRIGYMPQSPVLYDDLPALENVEFFGAA
FT                   HGVPGLRGRAREALRFVELEERAKDPVHTLSGGMKNRVSLACALVHEPEMLFLDEPTAG
FT                   VDPRLRSRFWAAFRELARGGATLFISTHLMDEATLCDRVAVLRQGRVVVSDSPRGILRR
FT                   GRTRLRVREGEREEERLIGGRPEDLAEALRGYGLRGSVSAVSVEADSLEQVVLSIIGEE
FT                   AG"
     MDAVEAVGLE KRYGKQVEAL RGVDLSVRKG EVFGLVGPNG AGKTTLIKAL VGSLRPSGGR        60
     ARVLGLDPLR DRPELRRRIG YMPQSPVLYD DLPALENVEF FGAAHGVPGL RGRAREALRF       120
     VELEERAKDP VHTLSGGMKN RVSLACALVH EPEMLFLDEP TAGVDPRLRS RFWAAFRELA       180
     RGGATLFIST HLMDEATLCD RVAVLRQGRV VVSDSPRGIL RRGRTRLRVR EGEREEERLI       240
     GGRPEDLAEA LRGYGLRGSV SAVSVEADSL EQVVLSIIGE EAG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page