(data stored in ACNUC7421 zone)

EMBL: CP000386.PE434

CP000386.PE434       Location/Qualifiers
FT   CDS             472116..474092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0441"
FT                   /product="Amylo-alpha-1,6-glucosidase"
FT                   /note="PFAM: Amylo-alpha-1,6-glucosidase; KEGG: sco:SCO7493
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03415"
FT                   /db_xref="GOA:Q1AYW3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW3"
FT                   /protein_id="ABG03415.1"
FT                   /translation="MQLPDRETETLEWAVSVVSPGAYAVSDGAGDFDAGAGGLYYRDTR
FT                   HLSRFVLEVGGERPVVRGREARGTAAEFLLEAAGLELVRRRRLGHGMEEEVEVRNPSGR
FT                   AVEARLSFGVGADFEDVFVVRGFAGRAERGEVVEEVREGGLRYLYRRGGFSRGTEVRAF
FT                   AEGAEPVAGSGGIHCLLRLGAGQRRVVRVSVALEEGGERVRAAGRRGAPYAAAPALETD
FT                   WEALRRSWERSVEDLAALTFDAGEGLLVPAAGAPWYMALFGRDALLAAYGAMILTPEPA
FT                   RNALRALARWQATERDDYTDAEPGKIPHELRRGELAYFREVPQPYYGTADATPLFLVLL
FT                   EEHRRWTADEGLARELEGAARRALDWLLAHADRTSGGFVAYESRSPAGLRNHGWKDSDG
FT                   SMLFRDGRRAGGGVAPCEVQGYAYDALLRTARLAESAWGDAALAGRLRDEAGDLRERFD
FT                   RDYWMEDRGCYALALDGEGRKVDSVTSNAGHLLWSGIVPEEKAPLLARRLLSEEMFSGW
FT                   GIRTMAEGEGGYDPLSYHNGSVWPHDSALIALGLARYGFRKEAARVAAALVEAAERFGY
FT                   RLPEVFGGERRREGEGPAGYPSSCSPQAWAAAAVPLLVRALLGAEPDPEARVLRSGPVL
FT                   PEGVRGLRLEGVPAFGGRHAVGG"
     MQLPDRETET LEWAVSVVSP GAYAVSDGAG DFDAGAGGLY YRDTRHLSRF VLEVGGERPV        60
     VRGREARGTA AEFLLEAAGL ELVRRRRLGH GMEEEVEVRN PSGRAVEARL SFGVGADFED       120
     VFVVRGFAGR AERGEVVEEV REGGLRYLYR RGGFSRGTEV RAFAEGAEPV AGSGGIHCLL       180
     RLGAGQRRVV RVSVALEEGG ERVRAAGRRG APYAAAPALE TDWEALRRSW ERSVEDLAAL       240
     TFDAGEGLLV PAAGAPWYMA LFGRDALLAA YGAMILTPEP ARNALRALAR WQATERDDYT       300
     DAEPGKIPHE LRRGELAYFR EVPQPYYGTA DATPLFLVLL EEHRRWTADE GLARELEGAA       360
     RRALDWLLAH ADRTSGGFVA YESRSPAGLR NHGWKDSDGS MLFRDGRRAG GGVAPCEVQG       420
     YAYDALLRTA RLAESAWGDA ALAGRLRDEA GDLRERFDRD YWMEDRGCYA LALDGEGRKV       480
     DSVTSNAGHL LWSGIVPEEK APLLARRLLS EEMFSGWGIR TMAEGEGGYD PLSYHNGSVW       540
     PHDSALIALG LARYGFRKEA ARVAAALVEA AERFGYRLPE VFGGERRREG EGPAGYPSSC       600
     SPQAWAAAAV PLLVRALLGA EPDPEARVLR SGPVLPEGVR GLRLEGVPAF GGRHAVGG         658
//

If you have problems or comments...

PBIL Back to PBIL home page