(data stored in ACNUC7421 zone)

EMBL: CP000386.PE438

CP000386.PE438       Location/Qualifiers
FT   CDS             476658..477137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0445"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: bha:BH1720
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03419"
FT                   /db_xref="GOA:Q1AYV9"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV9"
FT                   /protein_id="ABG03419.1"
FT                   /translation="MREEPKERLDPRAKTLWRLSGFLEMLPVLAAGAGTGWAVARFGGQ
FT                   PPAVAAVPVLATLLATLANALVLPELRWRRWRYEIREDEVDLQRGVLWVVRTLVPFARI
FT                   QHVDTRSGPLQRRFGLATVVFYTAAGPNRIPELSAPVAAEVRDRIAELTRERDEL"
     MREEPKERLD PRAKTLWRLS GFLEMLPVLA AGAGTGWAVA RFGGQPPAVA AVPVLATLLA        60
     TLANALVLPE LRWRRWRYEI REDEVDLQRG VLWVVRTLVP FARIQHVDTR SGPLQRRFGL       120
     ATVVFYTAAG PNRIPELSAP VAAEVRDRIA ELTRERDEL                              159
//

If you have problems or comments...

PBIL Back to PBIL home page