(data stored in ACNUC7421 zone)

EMBL: CP000386.PE44

CP000386.PE44        Location/Qualifiers
FT   CDS             45190..46065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0044"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: mta:Moth_1254
FT                   beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03025"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B003"
FT                   /protein_id="ABG03025.1"
FT                   /translation="MRRRALAPALVLVLLLFAACGGVRGGAGPPPSGALSVSFIDVGQG
FT                   DSVLVQAGGEDYLVDAGNPEEGPVVVDFLRERGVDDLEGLVSTSGDADHAGGLADVLEA
FT                   FPVERIYLSGYPKDTLTYAGFLRAVRAEEGADVERVRAGYRTEWGGVRVDVLNPPPGGY
FT                   FSGSNDNSVAVLLTYGRARVLLAGDAERRAEEYMAGGPHTGPLTVLKVNHHGSETSSGP
FT                   LFLSRFRPKVAVIQCGRDNPYGHPDPEVLERLRRVGARVFRTDLHGDVIVTIRRDLVEV
FT                   AVERPARAGA"
     MRRRALAPAL VLVLLLFAAC GGVRGGAGPP PSGALSVSFI DVGQGDSVLV QAGGEDYLVD        60
     AGNPEEGPVV VDFLRERGVD DLEGLVSTSG DADHAGGLAD VLEAFPVERI YLSGYPKDTL       120
     TYAGFLRAVR AEEGADVERV RAGYRTEWGG VRVDVLNPPP GGYFSGSNDN SVAVLLTYGR       180
     ARVLLAGDAE RRAEEYMAGG PHTGPLTVLK VNHHGSETSS GPLFLSRFRP KVAVIQCGRD       240
     NPYGHPDPEV LERLRRVGAR VFRTDLHGDV IVTIRRDLVE VAVERPARAG A                291
//

If you have problems or comments...

PBIL Back to PBIL home page