(data stored in ACNUC7421 zone)

EMBL: CP000386.PE441

CP000386.PE441       Location/Qualifiers
FT   CDS             complement(479590..482457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0448"
FT                   /product="SMC protein-like protein"
FT                   /note="PFAM: SMC protein-like; KEGG: mka:MK0690 SMC1-family
FT                   ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03422"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV6"
FT                   /protein_id="ABG03422.1"
FT                   /translation="MILKRLYLENYKQFRDPLELLPPEGAIGVVGANGAGKTTLFEAIL
FT                   WAFFGSRGTDARFANDSIPWSGGSASDRSAVEVTLEVGGTSYRVERSLRRGRTEARVCR
FT                   EPDEELVGGPSEVKRWVQEHLLGMDRTAFEATFFARQKELEFFAETTGVERRRKIAQLL
FT                   GISRVEEAQKLLREDRRAAENLRRALEGVLEGTDAEALEREIPAARARRDEARSRKDAA
FT                   QRELEERERELASARAEAERAEALYRSVTDLERRLDAAAAERERAGERADRLREHLGSL
FT                   EEDERKARELEPRTLGLAGVEREISALEEARDRERRREMAREEMQRLRRSAHDALMEAC
FT                   DLLEELDGEEPPLPGWGGLFGVEDEAARLREAVRLLGEAEDARRRAELRLKDLREAAEL
FT                   HGRLAELRGELRQLREEREAARGELARLEREISRSSGGEPPERLLERLREEEGRLRQRA
FT                   AGRRALAELEEQEARRLSQARRLIDTSHERAECPTCRRGFAAGEHAEVLETLRGQEEAA
FT                   RARAAEALSSSRRLEERASGLRRRMEEAGRLLERLRLLNEERRLAAARLESLDARLGPL
FT                   EEKAGALRERLGPSPAPTERELEAAERELEALRRLCGARPALEGLLSSYEKDCAAAAER
FT                   ANEAERLSRGPAYDEAAHRRLLERRSEIERLGGILETIRERLSQRPAVEEALRRALEER
FT                   RRAGERAARLREELSALDFDEGAYRRARERAGEAERRRDAARQRREEAAAELQELEHRL
FT                   QTLEADLARYREHRRKADEQAALSGELSQMDRLLGEFHGALAARLRPHLQREASALISV
FT                   LTDGRYSRMEFDDEYNIRLFDGLSDSYEISRFSGGEADIASLCARVALSKTISDRGPDT
FT                   LGFIVLDEVFGALDTDRRRNVLLALDRLKRTFGQIFLISHVGDIQESALLDEMWLVEVD
FT                   GAGKSSVRRLNAASKQVAEILQNSS"
     MILKRLYLEN YKQFRDPLEL LPPEGAIGVV GANGAGKTTL FEAILWAFFG SRGTDARFAN        60
     DSIPWSGGSA SDRSAVEVTL EVGGTSYRVE RSLRRGRTEA RVCREPDEEL VGGPSEVKRW       120
     VQEHLLGMDR TAFEATFFAR QKELEFFAET TGVERRRKIA QLLGISRVEE AQKLLREDRR       180
     AAENLRRALE GVLEGTDAEA LEREIPAARA RRDEARSRKD AAQRELEERE RELASARAEA       240
     ERAEALYRSV TDLERRLDAA AAERERAGER ADRLREHLGS LEEDERKARE LEPRTLGLAG       300
     VEREISALEE ARDRERRREM AREEMQRLRR SAHDALMEAC DLLEELDGEE PPLPGWGGLF       360
     GVEDEAARLR EAVRLLGEAE DARRRAELRL KDLREAAELH GRLAELRGEL RQLREEREAA       420
     RGELARLERE ISRSSGGEPP ERLLERLREE EGRLRQRAAG RRALAELEEQ EARRLSQARR       480
     LIDTSHERAE CPTCRRGFAA GEHAEVLETL RGQEEAARAR AAEALSSSRR LEERASGLRR       540
     RMEEAGRLLE RLRLLNEERR LAAARLESLD ARLGPLEEKA GALRERLGPS PAPTERELEA       600
     AERELEALRR LCGARPALEG LLSSYEKDCA AAAERANEAE RLSRGPAYDE AAHRRLLERR       660
     SEIERLGGIL ETIRERLSQR PAVEEALRRA LEERRRAGER AARLREELSA LDFDEGAYRR       720
     ARERAGEAER RRDAARQRRE EAAAELQELE HRLQTLEADL ARYREHRRKA DEQAALSGEL       780
     SQMDRLLGEF HGALAARLRP HLQREASALI SVLTDGRYSR MEFDDEYNIR LFDGLSDSYE       840
     ISRFSGGEAD IASLCARVAL SKTISDRGPD TLGFIVLDEV FGALDTDRRR NVLLALDRLK       900
     RTFGQIFLIS HVGDIQESAL LDEMWLVEVD GAGKSSVRRL NAASKQVAEI LQNSS            955
//

If you have problems or comments...

PBIL Back to PBIL home page