(data stored in ACNUC7421 zone)

EMBL: CP000386.PE443

CP000386.PE443       Location/Qualifiers
FT   CDS             complement(483675..484454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0450"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   bbr:BB2891 putative lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03424"
FT                   /db_xref="GOA:Q1AYV4"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV4"
FT                   /protein_id="ABG03424.1"
FT                   /translation="MTAERWSRYRWRLIRGEPVPPPVNHALDEVLTRRVGAGERPPTLR
FT                   FWGRFAPEVALGRFQSLGNEVDAGGVRRHGVAVVRRMTGGGAMFIEPASVITYSLYAPA
FT                   ELVAGMSAAESYPFLDAWVVEALRSLGIEAHHEPINDISSPEGKIGGSAQARAFGAVLH
FT                   HTTLAYDMDARKMLEVLRIGQEKISDKAVRSAERRVGPLRRQTRLPRERIVERMVSTFS
FT                   RYAGALEEDRVSPQEAEEAEALVRSKYGTPAWNALIP"
     MTAERWSRYR WRLIRGEPVP PPVNHALDEV LTRRVGAGER PPTLRFWGRF APEVALGRFQ        60
     SLGNEVDAGG VRRHGVAVVR RMTGGGAMFI EPASVITYSL YAPAELVAGM SAAESYPFLD       120
     AWVVEALRSL GIEAHHEPIN DISSPEGKIG GSAQARAFGA VLHHTTLAYD MDARKMLEVL       180
     RIGQEKISDK AVRSAERRVG PLRRQTRLPR ERIVERMVST FSRYAGALEE DRVSPQEAEE       240
     AEALVRSKYG TPAWNALIP                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page