(data stored in ACNUC7421 zone)

EMBL: CP000386.PE446

CP000386.PE446       Location/Qualifiers
FT   CDS             complement(486788..487906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03427"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV1"
FT                   /protein_id="ABG03427.1"
FT                   /translation="MLPGGTAREFVDRIGRALELAEERGIRPVAGSGPVDLEAEELAPA
FT                   GEAGGAPGEARHLESPPGARDPGRPDGRSRLRYFLDGVQSTREICRIGAAPVVATTVAA
FT                   AIAERSGRRLARMRFDGPPELVRAVILPVEAGDERIAELRDLLVQTGLEPLGYEEAPGS
FT                   PWHVLSSTEHVPAPDPSDYAGLRALAFGRARTLRERLETELLRRWEEDDRVLDNDDWLA
FT                   ADGQLGRPSPRAVGLVKSVARPEFGGAEAELLLDLAPGMRTTSFIPGWQVRRAVTDQRA
FT                   SWYVRCWPPQPGAGALGSLMRVEAARGTDPRMADEITRWILAERAPLAKPDPRWPAMIY
FT                   PIHHVERTLKPAVQGSERAYLRLQRQLRQHGR"
     MLPGGTAREF VDRIGRALEL AEERGIRPVA GSGPVDLEAE ELAPAGEAGG APGEARHLES        60
     PPGARDPGRP DGRSRLRYFL DGVQSTREIC RIGAAPVVAT TVAAAIAERS GRRLARMRFD       120
     GPPELVRAVI LPVEAGDERI AELRDLLVQT GLEPLGYEEA PGSPWHVLSS TEHVPAPDPS       180
     DYAGLRALAF GRARTLRERL ETELLRRWEE DDRVLDNDDW LAADGQLGRP SPRAVGLVKS       240
     VARPEFGGAE AELLLDLAPG MRTTSFIPGW QVRRAVTDQR ASWYVRCWPP QPGAGALGSL       300
     MRVEAARGTD PRMADEITRW ILAERAPLAK PDPRWPAMIY PIHHVERTLK PAVQGSERAY       360
     LRLQRQLRQH GR                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page