(data stored in ACNUC7421 zone)

EMBL: CP000386.PE448

CP000386.PE448       Location/Qualifiers
FT   CDS             complement(488509..489888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0455"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20 peptidase dimerisation; KEGG:
FT                   tth:TTC0765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03429"
FT                   /db_xref="GOA:Q1AYU9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU9"
FT                   /protein_id="ABG03429.1"
FT                   /translation="MQSGRKASGMELRERLVGMREELLEELKEFLRMPSVSAREDGGGA
FT                   FRECAEWVLGKLEEAGARARLLETGGHPVVYAEAGEGEGALLSYGHYDVQPPEPLELWE
FT                   SDPFEPAIRGDRLYARGVADDKGDVLARIQALRIYLREHGELPFRLRFLIEGEEEVGSP
FT                   SLGPFVRENAGLLSADACLWEGSIKDEAGRPVIFCGTKGLAYVELRARGPSHDLHSMYG
FT                   GIAPNPAWRLVQALRTIKNERGEITLDGFAELAEPPSPEDLEAISRIPFDDAALRTAWG
FT                   VEELDRGLSGREALEEMLLRPTANIAGMHSGYTGPGSKTIVPSEAFVKMDFRLVAGQSP
FT                   SRVVQLLREHLRRRGMEDIEVVDLHGLEPAKTPVNAPIVRLAKETWSDLGRDDALVYPT
FT                   IGGSGPTSLIATGLGIPTIMAGNVADSESRIHSPNESVRVEDYLETVAYFVRLFERFGG
FT                   R"
     MQSGRKASGM ELRERLVGMR EELLEELKEF LRMPSVSARE DGGGAFRECA EWVLGKLEEA        60
     GARARLLETG GHPVVYAEAG EGEGALLSYG HYDVQPPEPL ELWESDPFEP AIRGDRLYAR       120
     GVADDKGDVL ARIQALRIYL REHGELPFRL RFLIEGEEEV GSPSLGPFVR ENAGLLSADA       180
     CLWEGSIKDE AGRPVIFCGT KGLAYVELRA RGPSHDLHSM YGGIAPNPAW RLVQALRTIK       240
     NERGEITLDG FAELAEPPSP EDLEAISRIP FDDAALRTAW GVEELDRGLS GREALEEMLL       300
     RPTANIAGMH SGYTGPGSKT IVPSEAFVKM DFRLVAGQSP SRVVQLLREH LRRRGMEDIE       360
     VVDLHGLEPA KTPVNAPIVR LAKETWSDLG RDDALVYPTI GGSGPTSLIA TGLGIPTIMA       420
     GNVADSESRI HSPNESVRVE DYLETVAYFV RLFERFGGR                              459
//

If you have problems or comments...

PBIL Back to PBIL home page