(data stored in ACNUC7421 zone)

EMBL: CP000386.PE45

CP000386.PE45        Location/Qualifiers
FT   CDS             46145..46570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0045"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: tde:TDE1677 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03026"
FT                   /db_xref="GOA:Q1B002"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B002"
FT                   /protein_id="ABG03026.1"
FT                   /translation="MVSFNRVILAGNLTRDPELRFTSDGVPVCSFGIAVNRVRSRNEEV
FT                   DFFDVSAWRELGETIANYKKKGDPILIEGRLQYRTWEAQDGTRRSKVDIVADNVQFLGR
FT                   GGDPGEGGGSSGGQGRRGRGAGDEVDINESDFDDIPF"
     MVSFNRVILA GNLTRDPELR FTSDGVPVCS FGIAVNRVRS RNEEVDFFDV SAWRELGETI        60
     ANYKKKGDPI LIEGRLQYRT WEAQDGTRRS KVDIVADNVQ FLGRGGDPGE GGGSSGGQGR       120
     RGRGAGDEVD INESDFDDIP F                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page