(data stored in ACNUC7421 zone)

EMBL: CP000386.PE450

CP000386.PE450       Location/Qualifiers
FT   CDS             490587..491282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03431"
FT                   /db_xref="GOA:Q1AYU7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU7"
FT                   /protein_id="ABG03431.1"
FT                   /translation="MRDEAKSPEEWDFYQEHVYRLRKEEYRARGIRTEISSRRRERQSA
FT                   IELSREMFFLEVSEIAGRVAGGGRRARAAQEEARRYAARLDTHAFLKQLAAPHSGAVDL
FT                   YRRNYLELLRMGKPPAEAYYLSRIIGLAGEQEFRAALESIRRTGYPGGRLTYLVEKAAI
FT                   RIRDLPGGMILILLTFFVSLFAFVWATNEWGNASAGTILFVTLGLIAAGALMLISAVFI
FT                   VTFIRSINK"
     MRDEAKSPEE WDFYQEHVYR LRKEEYRARG IRTEISSRRR ERQSAIELSR EMFFLEVSEI        60
     AGRVAGGGRR ARAAQEEARR YAARLDTHAF LKQLAAPHSG AVDLYRRNYL ELLRMGKPPA       120
     EAYYLSRIIG LAGEQEFRAA LESIRRTGYP GGRLTYLVEK AAIRIRDLPG GMILILLTFF       180
     VSLFAFVWAT NEWGNASAGT ILFVTLGLIA AGALMLISAV FIVTFIRSIN K                231
//

If you have problems or comments...

PBIL Back to PBIL home page