(data stored in ACNUC7421 zone)

EMBL: CP000386.PE453

CP000386.PE453       Location/Qualifiers
FT   CDS             complement(492878..494386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0460"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines, uracil,
FT                   thiamine, allantoin; KEGG: bja:bll3347 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03434"
FT                   /db_xref="GOA:Q1AYU4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU4"
FT                   /protein_id="ABG03434.1"
FT                   /translation="MSGHHEVEEVLEHEREELEEAIHIEKHNSIEPVPEEYKDAKPLHQ
FT                   FWIWAGANIAPINWVLGALGIVLGLGLWETVLTLAVGNLLGMLLFGSFVLMGQRTGVTQ
FT                   MVLSRSAFGRRGAYLPAIFQIIIPTGWIAINTWIILDLTATLLELLGIPGTALTKVIVV
FT                   LVIMATQVGLATLGFYAIRSFEKWTVPPTLLILVAMSVVAWTGGDVNWSFAGEAEGAER
FT                   WTAMSQVMTAIGIGWGIGWLPYASDYSRFVPRATSRKRLFWASALGQFVPVLWLGLLGA
FT                   SIATTGTGVDPGLVIVQIFGALAIPVLFLVVHGPIATNILNVYSMSVAALAVDIKIPRH
FT                   VLSVIVGFFATLFTIYLVFAGDLAKNLDAWLASVVAWVSPWAAIMFIHYYIIRRENIDV
FT                   AALYQRPGESRVGDINWGAIACLVIGLAVTWSFLYGLVPVLQGPFARALNGLDLSWAVG
FT                   LTVTGALYYGLYRLGLVNPGGSRSGEEARQATPAEEPAQRGTGV"
     MSGHHEVEEV LEHEREELEE AIHIEKHNSI EPVPEEYKDA KPLHQFWIWA GANIAPINWV        60
     LGALGIVLGL GLWETVLTLA VGNLLGMLLF GSFVLMGQRT GVTQMVLSRS AFGRRGAYLP       120
     AIFQIIIPTG WIAINTWIIL DLTATLLELL GIPGTALTKV IVVLVIMATQ VGLATLGFYA       180
     IRSFEKWTVP PTLLILVAMS VVAWTGGDVN WSFAGEAEGA ERWTAMSQVM TAIGIGWGIG       240
     WLPYASDYSR FVPRATSRKR LFWASALGQF VPVLWLGLLG ASIATTGTGV DPGLVIVQIF       300
     GALAIPVLFL VVHGPIATNI LNVYSMSVAA LAVDIKIPRH VLSVIVGFFA TLFTIYLVFA       360
     GDLAKNLDAW LASVVAWVSP WAAIMFIHYY IIRRENIDVA ALYQRPGESR VGDINWGAIA       420
     CLVIGLAVTW SFLYGLVPVL QGPFARALNG LDLSWAVGLT VTGALYYGLY RLGLVNPGGS       480
     RSGEEARQAT PAEEPAQRGT GV                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page