(data stored in ACNUC7421 zone)

EMBL: CP000386.PE458

CP000386.PE458       Location/Qualifiers
FT   CDS             complement(499478..500284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0465"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mlo:mlr8761
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03439"
FT                   /db_xref="GOA:Q1AYT9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT9"
FT                   /protein_id="ABG03439.1"
FT                   /translation="METARTDDRNRNRPGTRSGTSALRHGIRVLQTFTREEPILGVSEI
FT                   ARRVGLHKSTVSRILATLEEAMLVERHPTSGRFRLGVGVIALAGPMLANLDVRRVARPF
FT                   LEELTRATGETTGLLVWSEGAAISVEQVASPKTVKHTIPIGTQFREHASASVKVFLAES
FT                   PPEEVQKVLDRGLKRYSERTVVDPEEYLKGLQRVRELGYAVNAGETSLEETGIAAPVRD
FT                   HRDQTVAAVLLSAPYYRTPPERIEELGELVRKTAEAISKRLGGASA"
     METARTDDRN RNRPGTRSGT SALRHGIRVL QTFTREEPIL GVSEIARRVG LHKSTVSRIL        60
     ATLEEAMLVE RHPTSGRFRL GVGVIALAGP MLANLDVRRV ARPFLEELTR ATGETTGLLV       120
     WSEGAAISVE QVASPKTVKH TIPIGTQFRE HASASVKVFL AESPPEEVQK VLDRGLKRYS       180
     ERTVVDPEEY LKGLQRVREL GYAVNAGETS LEETGIAAPV RDHRDQTVAA VLLSAPYYRT       240
     PPERIEELGE LVRKTAEAIS KRLGGASA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page