(data stored in ACNUC7421 zone)

EMBL: CP000386.PE459

CP000386.PE459       Location/Qualifiers
FT   CDS             complement(500453..501808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0466"
FT                   /product="Peptidase M20D, amidohydrolase"
FT                   /note="TIGRFAM: Peptidase M20D, amidohydrolase; PFAM:
FT                   peptidase dimerisation; KEGG: eli:ELI_13895 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03440"
FT                   /db_xref="GOA:Q1AYT8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT8"
FT                   /protein_id="ABG03440.1"
FT                   /translation="MAHSTLLEAVDRRVREAGPLVARIAREVWELAEVSHEEAESARLL
FT                   MDVLEESGFAVTSRGTAGVPTAFVAEWGSGEPVLGFLPEYDALPGLGNEAVPRREPRKD
FT                   GKTSGHGCGHNLLGAGLVGTAVALKGVMEERGLPGTLRVYGCAAEETEGAKVYMAREGL
FT                   FSDLAAALHWHPMAYAGVFNLRLAAMNQLAVEFFGRTAHAGMEPWKGRSALHAAELFAH
FT                   GINLMREHLEPTARVHYAFQRAGESPNVVPDYARVWLFVRDADRGRVEETTRWVERIAE
FT                   GAALATRTASKVELRFGMYDLLPNGPLAERMQVHLERVGVPEWTEEEQRFARECQENFG
FT                   VEARGMAAEVLPLSDEVTLGASSDVGDVSWNAPTMGCTMPAWPQGISAHTWPVVACGGT
FT                   SIGPKAALHAARVLAGIGAEILTDEELRAAARADFERRTRGRPYVSPLPFGE"
     MAHSTLLEAV DRRVREAGPL VARIAREVWE LAEVSHEEAE SARLLMDVLE ESGFAVTSRG        60
     TAGVPTAFVA EWGSGEPVLG FLPEYDALPG LGNEAVPRRE PRKDGKTSGH GCGHNLLGAG       120
     LVGTAVALKG VMEERGLPGT LRVYGCAAEE TEGAKVYMAR EGLFSDLAAA LHWHPMAYAG       180
     VFNLRLAAMN QLAVEFFGRT AHAGMEPWKG RSALHAAELF AHGINLMREH LEPTARVHYA       240
     FQRAGESPNV VPDYARVWLF VRDADRGRVE ETTRWVERIA EGAALATRTA SKVELRFGMY       300
     DLLPNGPLAE RMQVHLERVG VPEWTEEEQR FARECQENFG VEARGMAAEV LPLSDEVTLG       360
     ASSDVGDVSW NAPTMGCTMP AWPQGISAHT WPVVACGGTS IGPKAALHAA RVLAGIGAEI       420
     LTDEELRAAA RADFERRTRG RPYVSPLPFG E                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page