(data stored in ACNUC7421 zone)

EMBL: CP000386.PE463

CP000386.PE463       Location/Qualifiers
FT   CDS             506265..507587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0470"
FT                   /product="aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /note="KEGG: mlo:mlr4790 aminomethyltransferase; TIGRFAM:
FT                   glycine cleavage system T protein; PFAM: glycine cleavage T
FT                   protein (aminomethyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03444"
FT                   /db_xref="GOA:Q1AYT4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT4"
FT                   /protein_id="ABG03444.1"
FT                   /translation="MGERRTPLYDFHLRAGRGMVRGGGGYLFPSSYTSPVEEHLNVRRN
FT                   VGLQDLSSMGQIDVKGPGAERLLRRLLVNEVLDMQPGQLRYSTMCNEAGGVVDDVTVYK
FT                   FSDEHFMVVASSAPRLKSYRWIREHAEGSSAYVTDMTAGIALLAVQGPLSRPLLEGVVE
FT                   GAELERMRFFRFAACRVGEVEVIVSRSGYTGELGYEVYVPADQAREVWDFLLERGKEFE
FT                   LKPYGVEAMQSLRIEKALPLYGPDISEEHTPFHVGLERWIRFEKPDFIGREALLGVQRR
FT                   GIERRWVGLVLESEVPASNGDAIYSIADVASYREVIETGAEAGHYEEALLPGERKVGEV
FT                   TSSAWGPSVGKMLALGYVHTAHAWPGSNLIVDIGGGRPVPARVERTPFFDPENARVRSA
FT                   PLEDGRRLGQKGGAALHEAETQKNIPLRHTTTVADGGGQRP"
     MGERRTPLYD FHLRAGRGMV RGGGGYLFPS SYTSPVEEHL NVRRNVGLQD LSSMGQIDVK        60
     GPGAERLLRR LLVNEVLDMQ PGQLRYSTMC NEAGGVVDDV TVYKFSDEHF MVVASSAPRL       120
     KSYRWIREHA EGSSAYVTDM TAGIALLAVQ GPLSRPLLEG VVEGAELERM RFFRFAACRV       180
     GEVEVIVSRS GYTGELGYEV YVPADQAREV WDFLLERGKE FELKPYGVEA MQSLRIEKAL       240
     PLYGPDISEE HTPFHVGLER WIRFEKPDFI GREALLGVQR RGIERRWVGL VLESEVPASN       300
     GDAIYSIADV ASYREVIETG AEAGHYEEAL LPGERKVGEV TSSAWGPSVG KMLALGYVHT       360
     AHAWPGSNLI VDIGGGRPVP ARVERTPFFD PENARVRSAP LEDGRRLGQK GGAALHEAET       420
     QKNIPLRHTT TVADGGGQRP                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page