(data stored in ACNUC7421 zone)

EMBL: CP000386.PE467

CP000386.PE467       Location/Qualifiers
FT   CDS             511602..512483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0474"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR LysR,
FT                   substrate-binding; KEGG: ava:Ava_0824 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03448"
FT                   /db_xref="GOA:Q1AYT0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT0"
FT                   /protein_id="ABG03448.1"
FT                   /translation="MELSHIRYFVAAAEELHFGRAARRLHVTQPSLSKRVAGLERELGV
FT                   RLFHRTRREVRLTEAGEIFLEGARRVLEDALRAAEEARKAGRGELGRLEIGFFSPAIYG
FT                   VLPEILKEYHERFPEVRVTLHEWTSSVQLERMREGKIEIGFMRAPVEEAGFVTEHVFVE
FT                   PVVAALPEGHPQARREVVSPRELADEPFIMVPRSKEPNSFDRYVSICQRAGFSPKITQE
FT                   VFEIHAIVGLVATGMGVAFVQGSVANLKRPGVVYRPLDDPEARIGTAIVRRSSRPSPVL
FT                   RTFLETLQAFVA"
     MELSHIRYFV AAAEELHFGR AARRLHVTQP SLSKRVAGLE RELGVRLFHR TRREVRLTEA        60
     GEIFLEGARR VLEDALRAAE EARKAGRGEL GRLEIGFFSP AIYGVLPEIL KEYHERFPEV       120
     RVTLHEWTSS VQLERMREGK IEIGFMRAPV EEAGFVTEHV FVEPVVAALP EGHPQARREV       180
     VSPRELADEP FIMVPRSKEP NSFDRYVSIC QRAGFSPKIT QEVFEIHAIV GLVATGMGVA       240
     FVQGSVANLK RPGVVYRPLD DPEARIGTAI VRRSSRPSPV LRTFLETLQA FVA              293
//

If you have problems or comments...

PBIL Back to PBIL home page