(data stored in ACNUC7421 zone)

EMBL: CP000386.PE469

CP000386.PE469       Location/Qualifiers
FT   CDS             513233..513475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03450"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS8"
FT                   /protein_id="ABG03450.1"
FT                   /translation="MRPVARCEVCGNDYDLAFEVITAGERHVFDCFECAIHALAPVCEH
FT                   CGCRVIGHGVQAGDALFCCAHCAGAEGREGVRDRV"
     MRPVARCEVC GNDYDLAFEV ITAGERHVFD CFECAIHALA PVCEHCGCRV IGHGVQAGDA        60
     LFCCAHCAGA EGREGVRDRV                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page