(data stored in ACNUC7421 zone)

EMBL: CP000386.PE47

CP000386.PE47        Location/Qualifiers
FT   CDS             complement(47427..48221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0047"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: sma:SAV1786
FT                   putative MerR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03028"
FT                   /db_xref="GOA:Q1B000"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B000"
FT                   /protein_id="ABG03028.1"
FT                   /translation="MGGEKLTIGEAARLLGMTPRAIRHYERLGLLEEPERSAAGYRLYG
FT                   ARELLRLRRIKRLRELGLPLQRIGRLLEGPEAGTGLRPVLEFLLGEVESRLRELEGRRA
FT                   AILEALSRTDPEESAERPLLLRLLEERLGRRMEEMADPDLLEQGRRVWSLLDAFEWPEG
FT                   YREAHEALACHLARHPEALRRLLGLEERLAALAHAPPDSPEVEQLAEEFARYWAEQPSP
FT                   AQDAPAWPENVSGVLYELSLSRLSRAQRRCLELVRERLEARG"
     MGGEKLTIGE AARLLGMTPR AIRHYERLGL LEEPERSAAG YRLYGARELL RLRRIKRLRE        60
     LGLPLQRIGR LLEGPEAGTG LRPVLEFLLG EVESRLRELE GRRAAILEAL SRTDPEESAE       120
     RPLLLRLLEE RLGRRMEEMA DPDLLEQGRR VWSLLDAFEW PEGYREAHEA LACHLARHPE       180
     ALRRLLGLEE RLAALAHAPP DSPEVEQLAE EFARYWAEQP SPAQDAPAWP ENVSGVLYEL       240
     SLSRLSRAQR RCLELVRERL EARG                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page