(data stored in ACNUC7421 zone)

EMBL: CP000386.PE473

CP000386.PE473       Location/Qualifiers
FT   CDS             515915..517369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0480"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   tth:TTC1426 RtcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03454"
FT                   /db_xref="GOA:Q1AYS4"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS4"
FT                   /protein_id="ABG03454.1"
FT                   /translation="MSEKAGVADTVGFERLSEYRYRIPRQGKMRCDAVFYASRRILEDL
FT                   AAEDYASLRQLMGVATLPGIVEPALSMPDIHWGYGFPIGGVAAFDPEEGGVVSPGGVGF
FT                   DINCGVRLLVSDISREELADRKARLADELFRSVPSGVGRGRKDFRIGRPDLRRLLVEGP
FT                   SWLVERGYGEPGDLDGIESRGRLAGADPDAVSERAYQRGQPQLGTLGSGNHFLEVQYVD
FT                   EVYDEEAARAYGLHPGQVTVLIHSGSRGLGHQVCTEYVERFLQVAPKYGIELVDRQLAA
FT                   APIDSPEGRAYLGAMSAAANFAFANRQLIAHFTREAFARAGFGGRPLRVLYDLAHNNAK
FT                   LEEHGARRVLVHRKGATRAFGPGNPELPERYRGVGQPVLVPGDMGRYSFVLAGTEGSMR
FT                   ETFGSSAHGAGRKMSRRRAKKAARGRDLIREMEQVGILVRAAGRATVDEEMSEAYKDAA
FT                   EVVEVTDGAGIGKKVARLRPQIVVKG"
     MSEKAGVADT VGFERLSEYR YRIPRQGKMR CDAVFYASRR ILEDLAAEDY ASLRQLMGVA        60
     TLPGIVEPAL SMPDIHWGYG FPIGGVAAFD PEEGGVVSPG GVGFDINCGV RLLVSDISRE       120
     ELADRKARLA DELFRSVPSG VGRGRKDFRI GRPDLRRLLV EGPSWLVERG YGEPGDLDGI       180
     ESRGRLAGAD PDAVSERAYQ RGQPQLGTLG SGNHFLEVQY VDEVYDEEAA RAYGLHPGQV       240
     TVLIHSGSRG LGHQVCTEYV ERFLQVAPKY GIELVDRQLA AAPIDSPEGR AYLGAMSAAA       300
     NFAFANRQLI AHFTREAFAR AGFGGRPLRV LYDLAHNNAK LEEHGARRVL VHRKGATRAF       360
     GPGNPELPER YRGVGQPVLV PGDMGRYSFV LAGTEGSMRE TFGSSAHGAG RKMSRRRAKK       420
     AARGRDLIRE MEQVGILVRA AGRATVDEEM SEAYKDAAEV VEVTDGAGIG KKVARLRPQI       480
     VVKG                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page