(data stored in ACNUC7421 zone)

EMBL: CP000386.PE475

CP000386.PE475       Location/Qualifiers
FT   CDS             518040..518702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0482"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: eba:ebA2870
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03456"
FT                   /db_xref="GOA:Q1AYS2"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS2"
FT                   /protein_id="ABG03456.1"
FT                   /translation="MSVGETVRIEAGGARIEGDLEIPEGARGIVLFAHGSGSGRHSPRN
FT                   RFVAARLREESLLLGTLLIDLLTEQEEAEDARTGLLRFDVGLLAGRVEAATRWLLDNPR
FT                   TRGLRVGYFGASTGAAAALVAAARLPEAVGAVVSRGGRPDLAGEHLGRVRAPVLLIVGG
FT                   RDHTVLELNREAMRRLPPQTRLEVVPGATHLFEEPGALEEVARLAARWFARHLAGGR"
     MSVGETVRIE AGGARIEGDL EIPEGARGIV LFAHGSGSGR HSPRNRFVAA RLREESLLLG        60
     TLLIDLLTEQ EEAEDARTGL LRFDVGLLAG RVEAATRWLL DNPRTRGLRV GYFGASTGAA       120
     AALVAAARLP EAVGAVVSRG GRPDLAGEHL GRVRAPVLLI VGGRDHTVLE LNREAMRRLP       180
     PQTRLEVVPG ATHLFEEPGA LEEVARLAAR WFARHLAGGR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page