(data stored in ACNUC7421 zone)

EMBL: CP000386.PE476

CP000386.PE476       Location/Qualifiers
FT   CDS             518708..519691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0483"
FT                   /product="poly-gamma-glutamate synthesis protein (capsule
FT                   biosynthesis protein)"
FT                   /note="KEGG: dps:DP2296 poly-gamma-glutamate synthesis
FT                   protein (capsule biosynthesis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03457"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS1"
FT                   /protein_id="ABG03457.1"
FT                   /translation="MVVLNLAGDVMLGRGVNEALAEMPPEEVWGDVLPLLLEGGVRIVN
FT                   LECAITDHRRPWTRTPKVFHFRADPRAVRVLTAARIDAVSLANNHTLDFEERGLLDTIA
FT                   HLRSAGIACAGAGRDLAEASRPAVVEGGGERVALVAFTDNEPPFAAGPDRPGTNYLPVS
FT                   LEGEVLERVEEAVARARAEGAGTVVFSNHWGPNMVERPPECFRRFARAVIDRGADVYYG
FT                   HSAHVFQGVEVYRGRPILYDTGDFVDDYAVDPRLRNDRSFLFRVEVGEEGLRGLELFPV
FT                   RLPYARVRRAAGEEAEAIMERMERLSAEMGTRFERAGDRLLLRGPG"
     MVVLNLAGDV MLGRGVNEAL AEMPPEEVWG DVLPLLLEGG VRIVNLECAI TDHRRPWTRT        60
     PKVFHFRADP RAVRVLTAAR IDAVSLANNH TLDFEERGLL DTIAHLRSAG IACAGAGRDL       120
     AEASRPAVVE GGGERVALVA FTDNEPPFAA GPDRPGTNYL PVSLEGEVLE RVEEAVARAR       180
     AEGAGTVVFS NHWGPNMVER PPECFRRFAR AVIDRGADVY YGHSAHVFQG VEVYRGRPIL       240
     YDTGDFVDDY AVDPRLRNDR SFLFRVEVGE EGLRGLELFP VRLPYARVRR AAGEEAEAIM       300
     ERMERLSAEM GTRFERAGDR LLLRGPG                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page