(data stored in ACNUC7421 zone)

EMBL: CP000386.PE478

CP000386.PE478       Location/Qualifiers
FT   CDS             complement(520718..521440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0485"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: pca:Pcar_2717
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03459"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR9"
FT                   /protein_id="ABG03459.1"
FT                   /translation="MRLLFAGTRGEIEARTPRHAMHSALVVFCGGGRVMVDCGADWLGR
FT                   FGGLDPAAVVVTHAHPDHAWGLREGAPCPVYATRESWALMERYPVRERRVVEPRRPFRA
FT                   EGLVFEAFPVEHSTRAPAVGYRISAGRTAVFYAPDVVYIHGRGEALRGVELYAGDGASV
FT                   ARPLVRRRGEALIGHAPIRTQLTWCAKEGVRRAVFTHCGTEIVAGDEERLEREVRRLGA
FT                   ERGVEAALAYDGMEVGVP"
     MRLLFAGTRG EIEARTPRHA MHSALVVFCG GGRVMVDCGA DWLGRFGGLD PAAVVVTHAH        60
     PDHAWGLREG APCPVYATRE SWALMERYPV RERRVVEPRR PFRAEGLVFE AFPVEHSTRA       120
     PAVGYRISAG RTAVFYAPDV VYIHGRGEAL RGVELYAGDG ASVARPLVRR RGEALIGHAP       180
     IRTQLTWCAK EGVRRAVFTH CGTEIVAGDE ERLEREVRRL GAERGVEAAL AYDGMEVGVP       240
//

If you have problems or comments...

PBIL Back to PBIL home page