(data stored in ACNUC7421 zone)

EMBL: CP000386.PE479

CP000386.PE479       Location/Qualifiers
FT   CDS             complement(521437..523161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0486"
FT                   /product="PHP-like protein"
FT                   /note="PFAM: PHP-like; SMART: DNA polymerase X
FT                   Phosphoesterase PHP-like Helix-hairpin-helix DNA-binding,
FT                   class 1; KEGG: cbu:CBU_0490 hypothetical DNA polymerase /
FT                   putative histidinol phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03460"
FT                   /db_xref="GOA:Q1AYR8"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR8"
FT                   /protein_id="ABG03460.1"
FT                   /translation="MPVHNAEIAEILYEVADLLEIEGENPFRVRAYREAARTVENHPRS
FT                   LAEMAGEGEDLTRLPGIGEDLADKIREIARTGTLRQAEELRERVPPGLRGLLGVPGLGP
FT                   RRVRELHRRLGVESAAELERAAREGRVRRLPGFGAKTERNILEALGRKERPQRFRLSAA
FT                   EPAARALEEHLEGCGAVREAVVAGSFRRRKETVGDLDVVACSQEGRRVIEHFVAFEDIE
FT                   RVVSKGSTRSSVVLKNGLEADLRVVPEESFGTALLYFTGAQPHHVALRDMALKRRLKLN
FT                   EYGLFRGEERVAGRTEEEVYAQLGLRYIEPELREHRGEIEAARQGSLPQLLAQEDLRGD
FT                   LHSHTTATDGRSGLHEMAEAARERGYEYLAVTDHSRRLRVARGLDERRLREQMEEIDRL
FT                   NEELEGITLLKGAEVDILEDGSLDLPDGVLEELDVVVCSVHHKLRLPEREQTRRVLRAL
FT                   ENPNVNILAHPTGRLIGRREPYELDVERVMEAARERGCVLELNSNPERLDLNDAHCKLA
FT                   KEMGVKIAVSTDAHSADELANIRFGVGQARRGWLEREDVVNTRPLGELRRLLRREGA"
     MPVHNAEIAE ILYEVADLLE IEGENPFRVR AYREAARTVE NHPRSLAEMA GEGEDLTRLP        60
     GIGEDLADKI REIARTGTLR QAEELRERVP PGLRGLLGVP GLGPRRVREL HRRLGVESAA       120
     ELERAAREGR VRRLPGFGAK TERNILEALG RKERPQRFRL SAAEPAARAL EEHLEGCGAV       180
     REAVVAGSFR RRKETVGDLD VVACSQEGRR VIEHFVAFED IERVVSKGST RSSVVLKNGL       240
     EADLRVVPEE SFGTALLYFT GAQPHHVALR DMALKRRLKL NEYGLFRGEE RVAGRTEEEV       300
     YAQLGLRYIE PELREHRGEI EAARQGSLPQ LLAQEDLRGD LHSHTTATDG RSGLHEMAEA       360
     ARERGYEYLA VTDHSRRLRV ARGLDERRLR EQMEEIDRLN EELEGITLLK GAEVDILEDG       420
     SLDLPDGVLE ELDVVVCSVH HKLRLPEREQ TRRVLRALEN PNVNILAHPT GRLIGRREPY       480
     ELDVERVMEA ARERGCVLEL NSNPERLDLN DAHCKLAKEM GVKIAVSTDA HSADELANIR       540
     FGVGQARRGW LEREDVVNTR PLGELRRLLR REGA                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page