(data stored in ACNUC7421 zone)

EMBL: CP000386.PE482

CP000386.PE482       Location/Qualifiers
FT   CDS             524527..525195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0489"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   ava:Ava_3892 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03463"
FT                   /db_xref="GOA:Q1AYR5"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR5"
FT                   /protein_id="ABG03463.1"
FT                   /translation="MCGRYTLATPAERLAEEFGVSGPLPEIPPSYNVAPGRGVAAVVAD
FT                   DGRRRLEVLRWGLVPAWAEDPSIGNRMINARAESAAEKPSFRRAFRERRCLIPADGFYE
FT                   WRRLLEGGKQPYYVRRRDGAPFAFAGLWELWRGEGGEKIRSCTILTTRPNRLLREIHDR
FT                   MPVIVPPDLYGLWLEGGAEREELEAVLRPYPEEELEAYPVSRLVNSPANDGPRCIEPAA
FT                   "
     MCGRYTLATP AERLAEEFGV SGPLPEIPPS YNVAPGRGVA AVVADDGRRR LEVLRWGLVP        60
     AWAEDPSIGN RMINARAESA AEKPSFRRAF RERRCLIPAD GFYEWRRLLE GGKQPYYVRR       120
     RDGAPFAFAG LWELWRGEGG EKIRSCTILT TRPNRLLREI HDRMPVIVPP DLYGLWLEGG       180
     AEREELEAVL RPYPEEELEA YPVSRLVNSP ANDGPRCIEP AA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page