(data stored in ACNUC7421 zone)

EMBL: CP000386.PE489

CP000386.PE489       Location/Qualifiers
FT   CDS             532535..533887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0496"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase tyrosine protein kinase; SMART:
FT                   Serine/threonine protein kinase; KEGG: sth:STH1353
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03470"
FT                   /db_xref="GOA:Q1AYQ8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ8"
FT                   /protein_id="ABG03470.1"
FT                   /translation="MPIRREAAGGGRELETSAKTVFGDRYVVRERLGSGGMAVVYRAED
FT                   TLLGRDVAIKTLHRRYAEMPAFRRRFRQEARAMASLDHQNIVKVYDISPDGEAPFIVEE
FT                   YVGGRDLGSLLSRQRGGRLEEPFAVRVAVQLLKALAYAHWRGVIHRDIKPSNILITPGG
FT                   IVKVADFGIARLVEEDGEGDGEIIGSARYMSPEQLRGLEATQRSDVYSVGVLLYHCLTG
FT                   RPPFSGDVRSLVRQHLREAPRPPRELNRGISPQMEAVILRAMAKDPEARYPSATAMLDE
FT                   IEEGARQKARSGTREMPRRRMGRGRLALVSTLAVLLLGGGTAVGASGLAGYVDLSPRSS
FT                   VGQAVAAEPLRSAPPGIPEVAGQEASRDAPLVPVPDVRPYFDYSAREILVNRGFKVRIV
FT                   YAYREGYANRGVAWGTDPPAGTLAPAGSTVTVYSTPKDLYQPQIRTAGAAP"
     MPIRREAAGG GRELETSAKT VFGDRYVVRE RLGSGGMAVV YRAEDTLLGR DVAIKTLHRR        60
     YAEMPAFRRR FRQEARAMAS LDHQNIVKVY DISPDGEAPF IVEEYVGGRD LGSLLSRQRG       120
     GRLEEPFAVR VAVQLLKALA YAHWRGVIHR DIKPSNILIT PGGIVKVADF GIARLVEEDG       180
     EGDGEIIGSA RYMSPEQLRG LEATQRSDVY SVGVLLYHCL TGRPPFSGDV RSLVRQHLRE       240
     APRPPRELNR GISPQMEAVI LRAMAKDPEA RYPSATAMLD EIEEGARQKA RSGTREMPRR       300
     RMGRGRLALV STLAVLLLGG GTAVGASGLA GYVDLSPRSS VGQAVAAEPL RSAPPGIPEV       360
     AGQEASRDAP LVPVPDVRPY FDYSAREILV NRGFKVRIVY AYREGYANRG VAWGTDPPAG       420
     TLAPAGSTVT VYSTPKDLYQ PQIRTAGAAP                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page