(data stored in ACNUC7421 zone)

EMBL: CP000386.PE490

CP000386.PE490       Location/Qualifiers
FT   CDS             complement(533894..534337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1681 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03471"
FT                   /db_xref="GOA:Q1AYQ7"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ7"
FT                   /protein_id="ABG03471.1"
FT                   /translation="MRQDPNYGRQREPADELRSPFPGWGMSPEDERVWSVLAHLSALAG
FT                   LVGLMPLGALVIWLVYRDRSPRVGFHALQALLYQTMWLAIWVVGAVVGVVFTLVTLGLG
FT                   LVLVLPLALVFWLLPMAHSCYAAYRVGQGRDYRYPVVGHRAGW"
     MRQDPNYGRQ REPADELRSP FPGWGMSPED ERVWSVLAHL SALAGLVGLM PLGALVIWLV        60
     YRDRSPRVGF HALQALLYQT MWLAIWVVGA VVGVVFTLVT LGLGLVLVLP LALVFWLLPM       120
     AHSCYAAYRV GQGRDYRYPV VGHRAGW                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page