(data stored in ACNUC7421 zone)

EMBL: CP000386.PE491

CP000386.PE491       Location/Qualifiers
FT   CDS             complement(534359..534844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03472"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ6"
FT                   /protein_id="ABG03472.1"
FT                   /translation="MAAPPKPWSPLSARLEGRFAARGLPPLGFSLLEAEGPAFGRLRPE
FT                   GGRGARISAAGALVVIEREGRGRYRMLWEGVQALSAEGPPEGFRIAPGGEPWEAGLRLL
FT                   RNFATARGPGGRARVEGDLAGLRYGARFEGEAGLPAALFLLYRLAAARSRAFVVGGR"
     MAAPPKPWSP LSARLEGRFA ARGLPPLGFS LLEAEGPAFG RLRPEGGRGA RISAAGALVV        60
     IEREGRGRYR MLWEGVQALS AEGPPEGFRI APGGEPWEAG LRLLRNFATA RGPGGRARVE       120
     GDLAGLRYGA RFEGEAGLPA ALFLLYRLAA ARSRAFVVGG R                           161
//

If you have problems or comments...

PBIL Back to PBIL home page